KEGG   Burkholderia vietnamiensis LMG 10929: AK36_1690Help
Entry
AK36_1690         CDS       T03893                                 

Gene name
murI
Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00471  D-Glutamine and D-glutamate metabolism
bve01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    AK36_1690 (murI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:bve01011]
    AK36_1690 (murI)
Enzymes [BR:bve01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     AK36_1690 (murI)
Peptidoglycan biosynthesis and degradation proteins [BR:bve01011]
 Precursor biosynthesis
  Racemase
   AK36_1690 (murI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race Peripla_BP_6
Motif
Other DBs
NCBI-ProteinID: AJY07731
Position
I:complement(1818696..1819556)
Genome map
AA seq 286 aa AA seqDB search
MTTNRSTASAARPTAPIGIFDSGLGGLSVLRAVRAQLPGESFVYVADSRHAPYGPRDEAF
ITERTLAICEWLARDGAKALVVACNTATARAIATVRERLSIPLVGVEPGIKPAAAVSATG
VAGVLATQSTLNSPRFQALLDRYGAGRRFICQPGHGLVEAIERGDTNSPALRALLERYLQ
PMIDAGADTLVLGCTHYPFFTAAIRDLVGDRLTIVDTSDAIARQLARVLDERGLRAPAGA
PAAPPRFCSTSDGVQLRALASTLLGLDVPVETVTIASPNARDCATV
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaccgttccaccgcttccgcagcccgccccaccgcgccgatcggcatcttc
gattcggggctcggcgggctgtcggtgctgcgcgccgtgcgcgcgcagctgcccggcgaa
tcgttcgtctacgtcgccgactcgcgccatgcgccgtacggcccgcgcgacgaggcgttc
atcacggagcgcacgctggcgatctgcgaatggctcgcgcgcgacggagcgaaagcgctc
gtcgtcgcatgcaacacggccacggcacgcgcgatcgcgaccgtccgcgaacggctgtcg
atcccgctcgtcggcgtcgagccgggcatcaagccggccgccgcggtgtccgcgaccggc
gtcgccggcgtgcttgccacccaatcgacgctgaacagcccgcgctttcaggcgctgctc
gatcgctacggcgccggccgacgcttcatctgccagccgggccacgggctcgtcgaggcg
atcgagcgcggcgacacgaactcccccgccttgcgcgcgttgctcgaacgctacctgcaa
ccgatgatcgacgcaggcgccgacacgctcgtgctcggctgcacgcattacccgttcttc
acggcggcgattcgcgacctcgtcggcgatcgcctgacgatcgtcgacacgagcgacgcg
atcgcgcggcaactcgcccgcgtgctcgacgagcgcgggctgcgcgcgccggccggcgcg
cctgccgcgccgccgcgtttctgctcgaccagcgacggcgtgcaattgcgcgcactggcg
tcgacgctgcttggcctcgacgtgcccgtcgagaccgtcaccattgcgtcaccgaacgcg
cgcgactgcgcgaccgtttga

DBGET integrated database retrieval system