KEGG   Burkholderia vietnamiensis LMG 10929: AK36_1981Help
Entry
AK36_1981         CDS       T03893                                 

Definition
(GenBank) acetyl-CoA C-acyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00071  Fatty acid degradation
bve00072  Synthesis and degradation of ketone bodies
bve00280  Valine, leucine and isoleucine degradation
bve00310  Lysine degradation
bve00362  Benzoate degradation
bve00380  Tryptophan metabolism
bve00620  Pyruvate metabolism
bve00630  Glyoxylate and dicarboxylate metabolism
bve00640  Propanoate metabolism
bve00650  Butanoate metabolism
bve00900  Terpenoid backbone biosynthesis
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
bve01120  Microbial metabolism in diverse environments
bve01130  Biosynthesis of antibiotics
bve01200  Carbon metabolism
bve01212  Fatty acid metabolism
bve02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AK36_1981
   00630 Glyoxylate and dicarboxylate metabolism
    AK36_1981
   00640 Propanoate metabolism
    AK36_1981
   00650 Butanoate metabolism
    AK36_1981
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AK36_1981
   00072 Synthesis and degradation of ketone bodies
    AK36_1981
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AK36_1981
   00310 Lysine degradation
    AK36_1981
   00380 Tryptophan metabolism
    AK36_1981
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AK36_1981
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AK36_1981
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AK36_1981
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bve04147]
    AK36_1981
Enzymes [BR:bve01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AK36_1981
Exosome [BR:bve04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AK36_1981
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF2957
Motif
Other DBs
NCBI-ProteinID: AJY05679
Position
I:2143312..2144490
Genome map
AA seq 392 aa AA seqDB search
MTEAVIVSTARTPLAKSWRGAFNMTHGATLGGHVVAAALERAKLDPARIEDVIMGCANPE
GATGANIARQIALRAGLPVSVPGMTVNRFCSSGLQTIALAAQRIIAGEGDVYVAGGVESI
SCVQNEMNRHMIQEGWLVEHKPEIYWNMLQTAENVAKRYGIAKERQDEYGVRSQLRAAAA
LEAGRFRDEIVPITVRAGIADKATGRLYTQEVTVSADEGIRPDTTLEGVSKIRSAVPGGV
ITAGNASQFSDGAAACVVMNADIAQREGLQPLGVFRGFAVAGCEPDEMGIGPVFAVPKLL
KQTGLKIDDIGLWELNEAFAVQVLYCRDTLGIPDERLNVNGGAIAVGHPYGVSGARLTGH
ALLEGKRRGVKYAVVTMCIGGGQGAAGLFEIV
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaagccgtaatcgtatcgaccgcacgcacgccgctcgcgaagtcgtggcgcggt
gcattcaacatgacgcacggcgcgacgctcggcggccacgtggtcgcggccgcgctcgaa
cgcgcgaagctcgacccggcgcgcatcgaggacgtgatcatgggctgcgcgaaccccgaa
ggcgcgaccggcgcgaacatcgcgcggcagatcgcgctgcgcgccgggctgccggtcagc
gtgccggggatgacggtgaaccgtttctgttcttcagggttgcagacgatcgcgctcgcc
gcgcagcggatcatcgcgggcgagggcgacgtgtacgtcgcgggcggcgtcgagtctatc
tcgtgcgtgcagaacgaaatgaaccggcacatgatccaggaaggctggctcgtcgagcac
aagcccgagatctactggaacatgctgcagaccgcggagaacgtcgcgaagcgctacggg
atcgcgaaggagcgtcaggacgaatacggcgtgcgctcgcagctgcgtgcggcggccgcc
ctggaagccgggcgctttcgcgacgagatcgtgccgatcaccgtgcgcgcgggcatcgcc
gacaaagcgaccggacggctctacacgcaggaagtgacggtgtcggccgacgaaggcatc
cggcccgacacgacgctcgaaggcgtgtcgaagattcggtcggccgtgccgggcggcgtg
atcaccgcgggcaatgcgagccagttctcggatggcgcggcggcatgcgtggtgatgaac
gccgatatcgcgcagcgcgaagggctgcagccgctcggcgtgttccgcgggttcgcggtg
gccggctgcgaaccggacgagatgggcatcggtccggtgttcgcggtgccgaagctgctg
aagcagacgggcttgaagatcgacgacatcggcctgtgggaactgaacgaagcgttcgcc
gtgcaggtgctgtactgccgcgatacgctcggcatccccgacgagcgtctcaacgtgaac
ggcggcgcgatcgcggtcggccatccgtacggcgtgtcgggtgcgcgcctcaccggccat
gcgttgctcgaaggcaagcggcgcggcgtcaaatacgcggtcgtcacgatgtgcatcggc
ggcgggcagggcgcggccggcctgttcgaaatcgtctga

DBGET integrated database retrieval system