KEGG   Burkholderia vietnamiensis LMG 10929: AK36_3015Help
Entry
AK36_3015         CDS       T03893                                 

Gene name
hemN
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
bve  Burkholderia vietnamiensis LMG 10929
Pathway
bve00860  Porphyrin and chlorophyll metabolism
bve01100  Metabolic pathways
bve01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bve00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AK36_3015 (hemN)
Enzymes [BR:bve01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     AK36_3015 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: AJY07305
Position
I:3268696..3270087
Genome map
AA seq 463 aa AA seqDB search
MSSGSADTLFRPDLLAKYGANGPRYTSYPTALQFRDDFDPADYARAARDPGASSSELSLY
FHIPFCNTACFYCGCNKIATNNHRRARPYLEQLKRELALQAALFDPARPVTQLHWGGGTP
TFLSDAETAELMAATREHFALAPDMDAEFSIEIDPRTVTPATLVHLRNIGFNRLSLGVQD
FDPVVQQAINRVQPRAMTADLISAARATGFHSVSVDLIYGLPHQTVAVFARTLETIIELA
PDRLSVFGYAHMPHLFKMQRQIDDATLPSPETRIALLGLAIDMLTSAGYVYIGMDHFAKP
TDELVRAQQNGTLQRNFQGYSTRADTDLIGIGVSSIGKVGDVYAQNAKDLPGYGAALDAG
RLPIARGVRLTAEDRLRRDVITQLMCNLELPFSHIEAAHGVHFAEHFARELEALRPFERD
GLLSIAGDRLTIHPAGRMVVRNIAMAFDAYLAQTPRQRYSRTV
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagctccggttctgccgacaccctgttccgccccgatttgctcgcgaaatacggcgcg
aacggcccgcgctatacgtcctacccgaccgccctgcagttccgcgacgatttcgatccg
gccgactacgcgcgcgccgcgcgcgatcccggtgcgtcgtcgagcgagctgtcgctgtac
ttccacatcccgttctgcaacacggcctgcttctactgcggctgcaacaagatcgcgacc
aacaaccaccggcgcgcgcgcccgtatctcgaacagctgaagcgcgagctcgcgctgcag
gccgcgctgttcgaccctgcgcgcccggtcacgcagttgcactggggcggcggcacgccg
acctttctgtcggatgccgaaacggccgagttgatggccgccacgcgcgagcatttcgcg
ctggcgccggacatggacgccgaattctcgatcgagatcgacccgcgcaccgtcacgccg
gcgacgctcgtgcatctgcgcaacatcggcttcaaccgcctgagcctcggcgtgcaggat
ttcgacccggtcgtgcagcaggcgatcaaccgcgtgcagccacgcgcgatgacggccgac
ctgatctcggccgcacgcgcgacgggcttccattcggtcagcgtcgacctgatctacggg
ctgccgcaccagacggtcgccgtgttcgcacgcacgctggagacgatcatcgagctcgcg
ccggaccgcctgtcggtgttcggctacgcgcacatgccgcacctgttcaagatgcagcgg
cagatcgacgacgccacgctgccgtcgcccgaaacgcgcatcgcgctgctcggcctcgcg
atcgacatgctgacgtcggccggctacgtctacatcgggatggatcacttcgcgaagccg
accgacgaactcgtgcgcgcgcagcaaaacggcacgctgcagcgcaatttccagggctac
agcacgcgggccgataccgatctgatcgggatcggcgtgtcgtcgatcggcaaggtcggc
gacgtctacgcgcagaacgcgaaggacctgcccggctacggtgccgccctcgacgcgggc
cggctgccgatcgcgcgcggcgtgcgtctgacggccgaagaccgcctgcgccgcgacgtg
atcacgcagctgatgtgcaacctcgagctgccgttctcgcacatcgaagcggcgcacggc
gtgcacttcgccgagcacttcgcgcgcgagctggaagcgctgcgcccgttcgagcgcgac
gggctgctcagcatcgccggcgaccgcctgacgatccatccggccggccggatggtggtg
cgcaacatcgcgatggccttcgacgcgtatctggcgcaaacaccacgccagcgctattcg
cgcaccgtctag

DBGET integrated database retrieval system