KEGG   Beta vulgaris (sugar beet): 104883300Help
Entry
104883300         CDS       T03548                                 

Definition
(RefSeq) tyrosine/DOPA decarboxylase 1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00350  Tyrosine metabolism
bvg00360  Phenylalanine metabolism
bvg00380  Tryptophan metabolism
bvg00950  Isoquinoline alkaloid biosynthesis
bvg00965  Betalain biosynthesis
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104883300
   00360 Phenylalanine metabolism
    104883300
   00380 Tryptophan metabolism
    104883300
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    104883300
   00950 Isoquinoline alkaloid biosynthesis
    104883300
   00965 Betalain biosynthesis
    104883300
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvg04147]
    104883300
Enzymes [BR:bvg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     104883300
    4.1.1.105  L-tryptophan decarboxylase
     104883300
Exosome [BR:bvg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   104883300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DegT_DnrJ_EryC1 Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 104883300
NCBI-ProteinID: XP_010666091
UniProt: A0A0J8B553
Position
9
AA seq 510 aa AA seqDB search
MGSLDIKQESTPLMTNPLDPEEFRRQGYMVIDFLAEYYKNIEKYPVRSQVEPGYLRKRLP
ESAPYNPESMETILKDVQKDIVPGLTHWQSPNYFAYFPSSGSTAGLLGETLAAGFNVVGF
NWISSPASTELESIVMDWLANMLSLPKSFTFSGGGGGVMMGTTCEAILTTITAARDALLD
QIGRDNINKLVIYGSDQTHCSFFKSAKIAGISPKNFRTVKTSRAHAFALKPESLRAAIEA
DVNAGLIPLFLVATVGTTSTAAVDAVGPLCDVAKEYNMWVHVDAAYAGNACICPELRHMI
DGVEKADSFSFNAHKWFLTTLDCCCLFVKDPDSLVRCLSTNPEYLKNKATDTQQVVDYKD
WQITLSRRFRALKMWLVLRSYGVDYLRNFLRTHVDMAVYFEQMVTMDKRFEIVVPRSFSL
VCFRLSAAAVLQYSGQKFIEEETLNDLNSELLESINSDGRIYMTHSLVDGIFMIRFAVGA
TLTEIHHVTYAWKLVQEHTSAILARRIRNL
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgggttccctagacatcaagcaagaatccaccccactcatgacaaaccctttagaccca
gaagagttccgccgacaagggtacatggtaatagatttccttgctgagtactacaagaac
attgaaaaatatccggtccggagtcaggtggagccgggatacctccgaaagaggctgccg
gagtcagccccttataatcctgagtccatggaaactatcctcaaagatgttcaaaaggac
atcgttccagggctcacccactggcagagccctaattattttgcttatttccctagtagt
ggtagcacagcagggttactgggagaaactttagccgcagggtttaatgtggttggattc
aactggatttcttctccagcttctactgagctcgaaagtattgttatggattggttggct
aacatgcttagcttaccaaaatcctttaccttctctggtggtggaggtggtgttatgatg
gggacaacttgcgaagccatcttaactaccataaccgctgctcgagatgctcttttggac
caaattggacgtgataacatcaacaagctcgtcatttatggctctgatcaaactcactgt
tctttcttcaagtccgccaagattgccggaatttcacctaagaatttccgcaccgtcaag
acttcaagagctcatgctttcgcactcaaaccagaatcgcttagagcggcaattgaggcg
gatgtcaatgccggtttgatccctcttttcctcgtcgctacagtcggaacaacctcaact
gcggcggtagacgctgtaggcccattatgcgacgtggcaaaagagtacaatatgtgggtt
cacgtcgacgcggcctacgcagggaacgcgtgtatctgcccagagctccgccacatgatc
gatggtgtcgaaaaggcggattccttcagcttcaatgctcacaaatggtttctcacaaca
ctggattgctgctgcctttttgttaaggatcctgactccctagtccgttgcttatctacc
aaccctgagtaccttaaaaacaaagctactgacacccagcaagtggtggactataaagat
tggcagatcactctcagccgtcgattccgcgcccttaagatgtggcttgttctacgaagc
tacggcgtggattacctccgaaacttcctccgaacccacgttgacatggcggtctacttt
gaacagatggttaccatggacaagaggttcgagatcgtcgtcccccggagtttttctctt
gtttgcttccgcctctccgcggccgctgttctgcagtattcaggccagaagttcatagag
gaggaaacccttaatgatctcaactcggagcttcttgagtccattaactcggatggccgt
atttacatgactcactcgcttgttgatggcatcttcatgatccgtttcgctgttggagcc
actcttacagaaatccatcatgttacttatgcttggaaattggtgcaagagcatacaagt
gctattttagcacgcaggattcgcaatttatga

DBGET integrated database retrieval system