KEGG   Beta vulgaris (sugar beet): 104884538Help
Entry
104884538         CDS       T03548                                 

Definition
(RefSeq) aspartic proteinase A1
  KO
K08245  phytepsin [EC:3.4.23.40]
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bvg01002]
    104884538
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.40  phytepsin
     104884538
Peptidases and inhibitors [BR:bvg01002]
 Aspartic Peptidases
  Family A1: pepsin family
   104884538
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp SapB_1 TAXi_N SapB_2 TAXi_C zf-C4pol
Motif
Other DBs
NCBI-GeneID: 104884538
NCBI-ProteinID: XP_010667516
UniProt: A0A0J8B6A3
Position
Un
AA seq 513 aa AA seqDB search
MGTAFRNMLSSFFLVLLLSPLALSASNDGLVKVALKKKKLDQVSRLTTQYGSIEESIRMP
MKRYGLANNLASNDDADIVPLKNYLDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKC
YFSIACLFHSKYNARKSKSYTKNGKRAEIHYGTGAISGYFSEDHVTLGDLVVENQDFIEA
TREPSITFVAAKFDGILGLGFQEISVGKAVPVWYNMLDQGLVKEPVFSFWLNRNADEEEG
GEIVFGGVDPDHYKGEHTWAPVSQKGYWQFDMDDVSVDGETTGYCADGCSAIADSGTSLL
AGPTAVVAQINHAIGASGVASMECKAVVSQYGKQILELLLSETQPKKICSQIGLCTFDGK
RDVSMGIESVVDVNVDKSSGGLRDSMCTACEMAVVWMQNQLRQNQTEERILNYANELCER
LPSPMGESAVDCSSLSSMPSISFTIAGTTFDLTPEQYILKVGEGAAAQCISGFIALDVPP
PRGPLWILGDIFMGRYHTVFDYGNLRVGFAEAA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgggaactgcttttaggaatatgctttcgtctttttttcttgttcttcttttgtcaccc
ctggccttgtctgcctcaaatgatggcttggtcaaggttgctttgaagaagaaaaagttg
gaccaagtaagccggcttaccactcaatatggctctattgaagagtctattagaatgcct
atgaaaaggtacggtctcgccaacaatttggcgagcaatgatgatgcagatattgtccct
ttgaagaactatttggatgctcagtactttggcgagataggtgttggtactcctccacag
aaattcactgtgatatttgatacaggaagttctaacctatgggtcccttcctccaaatgt
tacttttctatcgcctgcctttttcattctaagtacaatgcaaggaagtcaaaatcatac
actaagaatgggaagagggctgagattcattatggtaccggagctatttcagggtacttt
agtgaagatcatgttacattgggagatctagttgttgagaatcaggattttattgaagcg
acaagagagcctagtatcacatttgtggctgctaagtttgatggtattcttgggcttggt
ttccaagaaatctccgttggtaaagctgttccagtttggtacaatatgcttgaccagggt
cttgtaaaggagcctgtattttccttctggctgaaccgaaatgcagatgaggaagaaggg
ggtgaaattgtttttggtggggttgatcctgatcattacaagggggaacacacatgggct
cctgtatctcagaaaggctattggcagtttgatatggatgacgtctcagttgatggcgaa
acaactggctactgtgctgatggttgttctgcgattgctgattctgggacatctctgttg
gctggcccaacggctgtggttgctcaaatcaatcatgcaattggtgcctctggggtagca
agtatggaatgtaaggcggtggtttcacaatatgggaaacagattctggagttgttgtta
tcagagactcaacccaagaaaatatgttcccaaattggtttatgtacctttgatggcaag
cgagatgttagtatgggcattgaaagcgtggttgatgtcaatgtggacaagtcttctggt
ggccttcgtgattccatgtgtacagcttgtgaaatggctgtggtatggatgcaaaatcaa
ctaagacaaaatcagaccgaagaacgtatcctgaattatgctaacgagctctgcgagcgc
cttcctagtccgatgggggagtctgctgttgactgtagtagtctttcatcaatgccatct
atatccttcactatagctggaacaacgtttgatctcactcctgaacagtacatcctcaaa
gtgggcgagggagctgcagcacaatgcatcagtggattcatagctttagatgtgcctcct
cctcgtggacccctctggattctgggggacatattcatgggtcggtaccacactgtgttt
gactatggaaatttgagagttggatttgcagaagctgcttaa

DBGET integrated database retrieval system