KEGG   Beta vulgaris (sugar beet): 104886011Help
Entry
104886011         CDS       T03548                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit C, chloroplastic/mitochondrial
  KO
K02435  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit C [EC:6.3.5.6 6.3.5.7]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00970  Aminoacyl-tRNA biosynthesis
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104886011
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:bvg03029]
    104886011
Enzymes [BR:bvg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     104886011
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     104886011
Mitochondrial biogenesis [BR:bvg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    104886011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glu-tRNAGln
Motif
Other DBs
NCBI-GeneID: 104886011
NCBI-ProteinID: XP_010668880
Position
2
AA seq 142 aa AA seqDB search
MASCGSRAMVTLRAGTIMLAGSTRTSTFPSLLLLKREKRNYSIKSSSLDPPDVGRLAETA
RISLTPQEVQDFGPKIHQVVEWFGQLQAVNLESVEPALRSDIDGDNLREDTPQTFENREA
IIAAIPSYDEPYIKVPKVLNKE
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttgtggcagcagagcgatggttacattaagagcaggaacaatcatgttagct
ggtagtacaagaactagcaccttccctagtttgctcttgttgaagagagaaaaacgcaat
tactccattaaatcgtcttctcttgaccctcctgatgtgggtcgtttggctgaaaccgcc
cgtatctctctgactcctcaggaggttcaggattttggtccaaaaattcatcaagttgtt
gagtggtttggacaacttcaagctgtaaatcttgaaagcgttgagccagcccttcgttca
gatattgatggtgacaatttgagggaagacacgcctcaaacatttgagaatagagaagct
attatagctgcaattccgagctatgacgaaccatatatcaaggtgcccaaagtcttgaac
aaagagtaa

DBGET integrated database retrieval system