KEGG   Beta vulgaris (sugar beet): 104886617Help
Entry
104886617         CDS       T03548                                 

Gene name
BIN46
Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV3
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00052  Galactose metabolism
bvg00500  Starch and sucrose metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    104886617 (BIN46)
   00500 Starch and sucrose metabolism
    104886617 (BIN46)
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104886617 (BIN46)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104886617
NCBI-ProteinID: XP_010669385
Position
2
AA seq 576 aa AA seqDB search
MHTMEKPVVWALLLCFVAVVNGVQTTDLGQNGASAGTTQPYRTAYHFQPLKNWMNDPNGP
LYYKGVYHLFYQYNPYSAIWGNMTWGHSISNDLVNWVHLEHALNPIEPYELGGCFSGSIT
MLPGGRPVIFYTGADTNNFQSQNLAFPKDPSDPLLREWVKSPHNPVITAEDDIEPSDFRD
PTTAWQAVDGTWQVLIGGKIDGRGMAYLYQSNDFINWTRSEKIFHSSVKTGMWECPDFYP
VSINGKDGVDNYLEKGNTKFVLKASFLDHDHYILGYYKAETNGFEVEATDFMEANTDWRY
DYGGKFYASKTFFDGGKKRRILWAWIMEADSRANDIKKGWSGLQSIPRVVWLSASGNQLM
QWPVEEIESLRKDEVEIKDKELEKGSLVEVVGITAAQADVEISFELPNLEDAEQMEPSWT
DPQLLCAQKNAAVEGRLGPFGLLVLASSNLTEETAIFFRVFKNHSRHIVLLCNDLSRSSL
SRDVRKTTFGAFLDINPLQESISLRTLIDHSIVESFGGGGKACITARVYPVLAVDKEAKL
FAFNKGSHNIKILKLNAWSMKEAKILPIMKRRKPPV
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgcataccatggaaaaacctgttgtttgggctttattattatgttttgttgcagttgtc
aatggagttcagactacagacctcggtcagaatggagcgtctgcaggtaccacgcagcct
tacaggactgcttaccacttccagcctctcaagaactggatgaatgatcctaatggacca
ttgtattataagggtgtttaccatctgttctatcagtataatccttattctgcaatatgg
gggaacatgacatggggtcattcaatatcaaatgatcttgtaaactgggttcacctcgag
catgcccttaatccaatcgagccttatgaattgggtggttgcttcagtgggtcaatcaca
atgcttccagggggaagacctgtcatattctacactggagcagatactaataatttccag
tcacagaatttggcatttccaaaggatccctctgatccccttctcagggaatgggtgaaa
tcacctcataatcctgtaattactgcagaagatgatattgagcctagtgatttcagagac
ccaacaacagcttggcaagctgttgatggcacatggcaagtgcttattggtggaaagata
gatggtcgaggaatggcgtatctgtaccaaagtaatgattttatcaattggactagaagt
gagaagatttttcactcctcagttaaaactggaatgtgggagtgtccggatttctatcct
gtaagcattaatggaaaagatggagtagacaactaccttgagaagggaaataccaaattt
gttctcaaggcaagctttcttgatcatgatcattatatactaggctattataaggctgaa
acaaatgggtttgaggtagaagcaactgacttcatggaagctaatactgattggaggtat
gactatggaggtaaattttatgcttcaaagacattttttgatggtgggaaaaaaagacga
atattatgggcatggataatggaggctgacagtagagcaaacgacataaagaaaggatgg
tcagggcttcagtctatccctcgagtagtgtggcttagtgctagtggaaatcaattaatg
cagtggccagtcgaagagattgaaagccttcgcaaggatgaagtagaaatcaaagacaag
gagctcgagaaagggtcattggttgaggtagttggcatcacagcagcgcaggctgatgtg
gaaatctccttcgaattgccgaatttagaagatgctgagcagatggaacctagttggact
gatcctcaattgctctgtgctcagaagaatgcagcagttgaaggcagattgggaccattc
ggcttgctggttttggcttccagtaacttaacagaggaaactgcaattttcttccgggtg
ttcaaaaatcatagtaggcatatagttttgttgtgtaatgacttgagtagatcctcatta
agtagagatgttcgtaaaactactttcggagcttttcttgacatcaatccccttcaggag
agcatttcacttagaaccttgatcgatcattccattgttgaaagttttggtgggggagga
aaggcatgcatcacggctagagtttacccagttttagcagttgacaaggaagcaaaattg
tttgcatttaacaaaggtagccataatattaagatcttgaagctcaatgcttggagcatg
aaagaagccaaaattcttcctattatgaaaagaagaaagccccctgtctaa

DBGET integrated database retrieval system