KEGG   Beta vulgaris (sugar beet): 104888882Help
Entry
104888882         CDS       T03548                                 

Definition
(RefSeq) wall-associated receptor kinase 2
Organism
bvg  Beta vulgaris (sugar beet)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase GUB_WAK_bind EGF_CA EGF_3 cEGF EGF hEGF WAK FXa_inhibition PIP49_C
Motif
Other DBs
NCBI-GeneID: 104888882
NCBI-ProteinID: XP_010672294
Position
3
AA seq 787 aa AA seqDB search
MGLRTDNYSFLNMDSILSVTLLIFLGLQIVEGGSPSQIALRNCPEKCGNISIPYPFGIGD
ECHYKTPSDNGFFYNLSCNLTTTPPSLTYGKSIEVVNITLEGEFRINIYISYVCYNFNRT
TPTYRRQSWMNMNKFTLSKTRNYIGAIGCDTYVWLNGTMSNTRKFRSGCMTICASTEEIG
NSSVCSGIGCCLVSIPEGVTNIDFKIHSLNDQQYVQDFNPCSVAFVVAKDYGTDDALPFS
VLQMLTQNRTFYRPLKFPVVYDWSLGYQNCREAQLSGEYLCKGNTTCIDWPEKEGYRCQC
KLGFRGNPYLHDCQDINECVEENSPCRQPATCSNTNGNFTCICPQGYRRRNSEDRDDLCI
AETSKQLSMLIIKIIGGIAGGLIISLIFAFWYNWQHGNRKLLKIREKFFHQNGGYLLQQK
LQGRDMSVGHSVEMFTVEELKKATNNYGESSIIGRGGFGMVYKGTLSENRKIRNQVVAIK
RSLKIDSSQVEQFINEIIALSQINNKNVVKLLGCCLETEVPSLVYEYISNGTLYDHLHDE
RKARFFTWDIRLKIATQVSEVLAYLHTTISIPIIHRDIKSANILLDDEFTAKVADFGASK
LAPADQEQLATMVQGTCGYLDPEYMQTGELTEKSDVYSFGVVLVELLTGEKAICYAKPEN
ERSLAVYFLRKVKEDRLFEILDDKITSDGAIEQFKEVAYLAKRCLKLKGEDRPAMKEVAR
ELDRIGGIGSHPWSNNKGVLLEEESEYLLGQTQDVIKHGYGSNEAINDSLSSSQSTVVQL
VALNDGR
NT seq 2364 nt NT seq  +upstreamnt  +downstreamnt
atggggctcagaactgataattattctttcttgaatatggattccatactttcagtaaca
ctactaatatttttaggcctccaaattgtggaaggaggatctccctcacaaatagccctt
cgtaattgcccagaaaagtgcggcaatatcagcatcccttatccctttggaatcggtgat
gaatgtcattacaaaacaccctcagataatggtttcttttacaatctcagctgtaacctt
actaccactcctccaagtctaacttacgggaagagcatagaggtagtgaacatcactttg
gaaggtgagtttcggataaatatctatatttcttacgtttgttacaactttaataggact
acgcctacttatagacgtcaatcttggatgaatatgaataaatttactctgtcgaaaact
cgaaattatattggtgccattggttgcgacacctacgtatggctcaatggtacgatgagt
aacacgagaaaatttcgttcaggatgcatgactatatgtgcttcaacagaagaaataggg
aatagcagtgtatgctccggaattggctgctgtctggtctccattccagaaggagtaaca
aatatagattttaagattcatagtttgaacgatcagcaatacgtccaggatttcaatccg
tgcagtgtcgcattcgtggtggcaaaggattatggtacagatgatgcattacccttctct
gtcttgcagatgctaacccaaaatcgtactttttatcggccattgaagttccctgttgtg
tatgattggtcacttggataccaaaattgtagagaagctcaactttctggggagtactta
tgcaaaggaaatactacttgcattgactggccagaaaaagaagggtaccgctgccagtgc
aaactcggattccggggtaatccctaccttcatgattgtcaagatattaacgaatgtgtg
gaagaaaactccccgtgtcgacaaccagcaacttgttccaacacaaatggaaattttact
tgcatatgcccacaaggctacaggcgtcgcaatagtgaagacagagatgatctttgtatc
gctgaaacctccaagcaactgtcgatgctaatcatcaaaattattggaggtattgctggc
ggcctcattatttccctcatttttgcattttggtataactggcaacatggaaatagaaaa
cttttgaagataagggagaagtttttccatcagaacggtggttatcttttacagcaaaaa
cttcaaggacgagatatgtcagtgggtcattcggttgaaatgttcacagttgaagaactt
aagaaggccacaaataattatggagagagtagcatcattggtcgaggaggtttcggcatg
gtttacaagggaacactatccgaaaacagaaaaattcgtaaccaagtagtcgccataaaa
agatcacttaagatagattcgagccaagtggagcagttcataaatgaaatcattgccttg
tcacagatcaacaacaaaaacgtggttaaactcttaggctgttgtttagagacagaggta
ccgtcacttgtatatgaatatataagcaacggtacgctttatgaccatttgcacgatgaa
agaaaggcgcgtttttttacatgggatattcgcttaaagatagcaacccaagtttccgag
gtcttggcatatttgcacactacaatttctataccgataatacaccgggatattaaatcc
gcgaacatactcttagatgacgaattcacagcaaaagtcgctgactttggggcatctaaa
ctagcgccagcggatcaagagcaattggcaacaatggttcaaggaacatgtggttatctt
gatcctgagtacatgcaaactggggaactaactgagaagagcgatgtttatagctttggt
gttgttcttgttgagctattaaccggagagaaggcaatctgttatgctaaacccgagaat
gagagaagccttgctgtatattttcttaggaaggtaaaagaagaccgtttgtttgagatt
cttgatgataaaataacgagtgatggagccattgagcaatttaaagaagttgcgtatctt
gcgaagaggtgcctgaaattgaaaggagaagatcgccccgcaatgaaggaagttgcacga
gaactagacaggataggtggaattggttcacatccatggtcaaacaataagggtgtattg
cttgaagaagagagtgaatatttgcttggtcaaacacaggatgttatcaaacatggatat
ggcagcaatgaggcgatcaacgattcgttgagcagcagccaaagtacggttgtgcaattg
gtggctttgaatgatgggagatga

DBGET integrated database retrieval system