KEGG   Beta vulgaris (sugar beet): 104889100Help
Entry
104889100         CDS       T03548                                 

Definition
(RefSeq) methylenetetrahydrofolate reductase 1
  KO
K00297  methylenetetrahydrofolate reductase (NADPH) [EC:1.5.1.20]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00670  One carbon pool by folate
bvg01100  Metabolic pathways
bvg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    104889100
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.20  methylenetetrahydrofolate reductase [NAD(P)H]
     104889100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MTHFR
Motif
Other DBs
NCBI-GeneID: 104889100
NCBI-ProteinID: XP_010672546
Position
3
AA seq 594 aa AA seqDB search
MKVIEKIRAAEAQNQILFSFEYFPPKTDDGVENLFERMERMVSHSPSFCDITWGAGGSTA
DLTLEIANRMQNIVCVETMMHLTCTNMPVEKIDHALTTIKSNGLQNVLALRGDPPHGQDK
FVQVEGGFACALDLVNHMRSKYGDYFGITIAGYPEAHPDAIGANGLATEEAYASDLAYLK
RKVDAGADLIVTQLFYDTDNFLKFVNDCRQIGITCPIVPGIMPINNYKGFQRMTGFCKTK
IPQEITDALEPIKDNEEAVKAYGIHLGTEMCKKILASGIKQLHLYTLNMEKSALGILLNL
GLIEESKIQRPLPWKRPANVNRVKEDVRPIFWANRPKSYITRTMGWDQYPHGRWGDARNA
SYGALSDHQFMRPRARDKKLQEEWAVPLQSAEAIHEMFKNFCLGKLKSNPWSELDGLQPE
TKIIDEKLGDINMKGFLTINSQPAVNGEKSDSPTVGWGGPGGYVYQKAYVEFFCAKEKLN
ALVEKCKSLTSITYMAVNKGGDLISNVAQTDVNAVTWGAFPSKEIIQPTVVDSASFMIWK
DEAFEIWSRSWAQLYPEGDSSKKLLEEVQNSYYLVSLVDNDYIHGDLFSVFTGL
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtgattgagaagatcagagcagcagaagctcagaatcaaatcctattttccttc
gaatactttccccctaaaaccgacgatggtgtcgaaaatctcttcgaaagaatggagaga
atggtgtctcattccccttctttttgtgacattacttggggtgctggaggatctactgct
gatctaaccttagaaattgctaatcgtatgcaaaacattgtttgtgttgaaactatgatg
catcttacttgtactaatatgcctgttgaaaagattgatcatgcgcttactactattaaa
tctaatggattgcaaaatgttcttgctcttcgtggtgatccacctcatggtcaggataaa
tttgttcaagttgaaggcggatttgcttgcgctcttgatcttgttaatcatatgcggagc
aaatatggggattactttgggattactattgctggttatcctgaggcacatcctgatgct
attggagctaatggtttggcaactgaagaagcatatgctagtgatctggcttacttgaag
agaaaggttgatgctggtgctgatcttatcgtcacgcagctgttttatgataccgataat
tttctcaagtttgttaatgattgtcgccaaattggaattacttgtccaattgttcctggc
attatgcccattaataactataagggctttcaacgaatgactggtttctgtaaaacaaag
attcctcaagagatcactgatgcattggagccaattaaggacaatgaagaagcagtgaaa
gcctatggtattcatcttggaactgaaatgtgcaagaagattttggctagtggaatcaaa
cagctgcatctttataccttgaatatggagaagtctgcactaggaatattgctgaatctt
ggattaattgaagagtccaaaattcaaagaccattaccttggaaacgcccagcaaatgtt
aaccgtgttaaggaagatgttaggcccatcttttgggctaaccgtccaaaaagctacatc
acacgaacaatgggatgggatcaatacccccatgggcgttggggtgatgctcgcaatgca
tcctatggagcattaagcgaccaccagtttatgagaccacgtgcacgtgataagaagctg
caagaagagtgggctgtcccactgcaaagtgctgaagctatacacgagatgttcaagaac
ttttgccttggtaagctgaaaagcaatccttggtctgaattagatggccttcagccagaa
acaaagatcatcgatgaaaaattgggcgacattaatatgaaaggctttctcaccatcaac
agtcaacctgcagttaatggagaaaaatcagactcccccactgttggatggggtgggcct
ggtggctatgtataccagaaagcctatgtagaattcttttgcgcaaaggagaagttgaat
gcacttgttgaaaaatgcaaatctcttacatctataacctacatggcggtgaacaaagga
ggtgatttgatctcaaatgttgcccaaactgacgtgaacgctgtaacatggggtgcattc
ccttcaaaggagattatacaaccaactgttgtggattctgccagctttatgatctggaaa
gacgaagcctttgaaatctggtccagatcatgggctcaattatatccagagggtgactca
tccaagaaattgcttgaagaggtgcaaaatagctactacttagtcagcttggtggataat
gattatatccatggtgatctattttctgttttcactggtctttga

DBGET integrated database retrieval system