KEGG   Beta vulgaris (sugar beet): 104892056Help
Entry
104892056         CDS       T03548                                 

Gene name
BIN44
Definition
(RefSeq) acid beta-fructofuranosidase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00052  Galactose metabolism
bvg00500  Starch and sucrose metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104892056 (BIN44)
   00500 Starch and sucrose metabolism
    104892056 (BIN44)
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104892056 (BIN44)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 104892056
NCBI-ProteinID: XP_010676174
Position
5
AA seq 691 aa AA seqDB search
MSESSDSILPYSYAPLATKNEFNGFGPGENQPRRRSLKIGLAVFSTLMICALLMSILDYN
NNVIENNVSNNNAPNKYNNVVGDLTLRPPPENVASVEVMPGSKDLLFKVSRGKPHGVSQK
ANSLPLRGLKVPFFDWNDLQLAWQRTAFHFQPQKNWMNDPNGPLYYNGWYHFFYQYNPAG
AVWGNIVWGHAVSKDLIRWKHLPIAMVADRWYDFNGVWTGSATILPDGQIMMLYTGSTNE
SVQVQNLAYPANLSDPLLLEWVKYPGNPVLVPPPGIGKLDFRDPTTAWLTSEGKWRITIG
SKLNKTGISLVYDTTDFKNYELLSNILHAVQGTGMWECVDFYPVSVAEPNGLDTSTNGPS
VKHVLKASMDDDRNDYYTLGTYIEDNVTWVPDNPAIDVGIGLRYDYGRFYASKTFYDHEK
KRRILWGWITEGDSEAADVKKGWASLQGIPRTVLFDQKTRTNLVQWPVEEVETLRQNNKD
FDKVEVPAGSVVPLDVSAATEIDIIAEFDIDKEALENLPVSEEHYSCPASKGAAQRGALG
PFGLLVLANNDLAEQTPVYFYVIKTLSGSFKTFFCTDLSRSSAATDVFKNIYGSTVPVLK
GEKLSMRILVDHSIVEAFAQGGRTCITSRVYPTKAIYKETKLYVFNNATTATVTASIKTW
QMSSARMLRNSIWVHLIMFFSTFIFIGRPLI
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaatcctcagattcaatccttccttactcttatgcacctttggccacaaaaaat
gagttcaatggtttcggaccgggcgaaaaccagcctaggagaaggtccttaaagattggg
ttagcagtgttttcgacccttatgatatgtgcattgttaatgagcatattggattacaac
aacaatgttattgagaataatgtgtctaacaataatgcacccaacaaatacaataatgtt
gttggtgatctaactttaaggccaccacctgaaaatgtggctagtgtagaagttatgcct
ggatcaaaggatttgttgtttaaggtgtcgcgtggtaagcctcatggtgtatctcagaag
gctaattctttgcctttgcgtggccttaaggtgcctttttttgattggaatgatcttcag
ttagcttggcaaagaactgcttttcattttcagcctcagaagaattggatgaatgatcca
aacggtccattatattacaatgggtggtaccacttcttctaccagtacaaccctgcaggt
gcagtatggggaaacatagtatggggtcatgctgtgtccaaggacctcataaggtggaag
caccttcccatagccatggtagcggaccgttggtatgatttcaatggagtgtggactggc
tcagccactatcctacctgatggtcaaatcatgatgctctacactggatcaaccaacgaa
tcggtccaagtccaaaaccttgcctatccagctaacttatctgacccacttctcctggaa
tgggttaagtaccctggtaacccggtccttgtccctcctccaggaatcggcaaattggat
ttccgcgaccctacaactgcttggctaacctctgagggtaaatggaggatcacaattggg
tccaagctcaacaaaacaggcatttctctagtgtatgataccactgactttaagaactat
gagctactgagcaacatccttcatgctgtgcaaggcactggtatgtgggagtgtgttgac
ttctatccagtctctgttgctgagcctaatggacttgatacatccactaacggcccatca
gtaaagcatgtgcttaaggcaagcatggatgatgacaggaacgattactacacgttggga
acctatattgaggacaatgttacatgggtgcctgataatcctgccattgatgttggtatt
ggactaaggtatgattatggtagattttacgcttctaagacattttatgaccatgaaaag
aagagaaggatcttgtggggttggattacagaaggcgatagtgaagcagctgatgtaaag
aaaggatgggcatctctccagggaattccaagaactgtgctgtttgatcaaaagactaga
accaacttagttcaatggccagtagaagaagtagaaactctgagacagaacaacaaggat
tttgacaaggttgaagttcctgcaggatctgttgtacccttggatgtcagtgcagccacc
gagattgatataatagcagaattcgacattgataaagaggcattggaaaatttaccagtt
tcggaagagcactatagctgcccagccagcaagggagccgctcagagaggcgctctagga
ccttttggattgttggttcttgctaacaatgaccttgctgagcagactcctgtctacttc
tatgtcatcaaaacccttagtggcagcttcaaaaccttcttctgcactgatttatcaagg
tcatctgcagccactgatgttttcaaaaacatctatggtagcacagttccagttctcaaa
ggagaaaaattatccatgagaattctggtggatcattcaatagtagaagcctttgcacaa
ggtggtagaacctgcatcacatcccgagtttacccaacaaaagcaatctacaaagaaaca
aagctatatgtgttcaacaacgcaactacagctactgtaaccgcttccatcaaaacctgg
caaatgagctctgcacgtatgcttcgcaactccatttgggttcatctcatcatgtttttt
tctacattcatcttcattggccgccccttaatctga

DBGET integrated database retrieval system