KEGG   Beta vulgaris (sugar beet): 104892148Help
Entry
104892148         CDS       T03548                                 

Definition
(RefSeq) uncharacterized LOC104892148
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00230  Purine metabolism
bvg00240  Pyrimidine metabolism
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
bvg04016  MAPK signaling pathway - plant
Module
bvg_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bvg_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bvg_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    104892148
   00240 Pyrimidine metabolism
    104892148
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    104892148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bvg04131]
    104892148
Enzymes [BR:bvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     104892148
Membrane trafficking [BR:bvg04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    104892148
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDK PH
Motif
Other DBs
NCBI-GeneID: 104892148
NCBI-ProteinID: XP_010676289
Position
5
AA seq 489 aa AA seqDB search
MGDGPRTIEIIPNYFETSASADSPLPRSSDTSISGEDSPRTSTSGTTSHLERNSFSSKAS
TGGTRFVHNRSLTRNNFRTASFMLRLFSLKGLRKITGLNGEEKVELSAVELESLRSELAD
VEEREAHFKAQLEHLDEILRWARLTGYLYMRTRWAALPGELPPIDDCDVDDWVPRFTVLQ
GSCIFFYLSSTDLSPQDSALLSDIVEVGSLPCIVRESEEIWHCFYIVTRYGLRIECSSGS
EIQVDSWLRALRTECKSDPDKRSATRVARSLLSTSKNASRFLPEGRTVAATAAVSLRGKA
PYLASFGGANATGTWLSAALAIPAAVYMLQDQEAHAAEMERSFIAIKPDGVQRGLISEII
ARFERKGFKLVAIKVVVPSKEFAQKHYHDLKERPFFNGLCDFLSSGPVVAMVWEGEGVIR
YGRKLIGATDPQKSEPGTIRGDLAVVVGRNIIHGSDGPETAKDEINLWFKPEELVNYTNN
AEKWLYGDN
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgggtgatggaccaagaactatagagatcataccaaattattttgagacttcagcttct
gcagattctcctctacccagaagttcagatacctcaatttctggtgaagactctcctcgt
acatcaacatcgggcacaacatctcatctagaaagaaactcattttcttcaaaagcaagt
actggcggtaccaggttcgttcacaatcgttcattgactaggaacaattttagaactgct
tcattcatgttgaggttatttagtttgaaagggctacgcaagataactggtcttaatggt
gaagagaaggttgagctgagtgctgtagaactagaatcccttcgatcagaacttgccgat
gtagaagagagggaggctcatttcaaagcacagttggagcatctggatgaaattttgcgt
tgggcacgactaacaggatacttgtatatgagaacacgatgggcggcactgccaggtgaa
ctacctcctattgatgattgtgatgtcgatgattgggttccacgatttacagtcctgcaa
ggatcctgtattttcttctacctgtcatctacagatttgagtcctcaagattcagctctt
ctttccgatattgttgaagtgggctcattgccatgcatagttcgagaaagtgaggaaata
tggcattgcttttatattgtgacgcgttatggactcaggattgaatgttccagtggttct
gaaatccaggttgattcttggttgagagcgttacgaacagagtgcaagtctgatcctgat
aaaagatctgctactagggttgctcgttctcttctctccacttccaagaacgcatcccgc
ttccttcctgaaggacgcacagtagctgctacagctgcagtttctctgagaggaaaagca
ccttacttggcttcttttggaggagcgaatgcaaccggaacatggttgtccgctgcattg
gccatccccgcagcagtttacatgcttcaggaccaggaggcccatgctgcagagatggag
cgtagtttcattgctatcaaaccggatggagttcagagagggctgatctccgaaattata
gcacgttttgaacggaagggtttcaagcttgttgcaatcaaagtagtggtcccatcaaag
gaatttgcccaaaagcattatcatgacctgaaggagagacctttcttcaatggcctctgt
gattttctaagctctggtccagttgttgctatggtttgggaaggtgaaggtgtgattaga
tatggcagaaaactcattggagccactgacccacagaaatcagaaccaggaaccatcaga
ggtgatcttgccgttgttgttggaagaaatattatccacggaagtgacgggccagagact
gcaaaggatgaaattaacttatggttcaagccagaagaattggtcaattacacaaacaat
gctgagaaatggctctatggagacaactga

DBGET integrated database retrieval system