KEGG   Beta vulgaris (sugar beet): 104893144Help
Entry
104893144         CDS       T03548                                 

Definition
(RefSeq) heat shock cognate 70 kDa protein-like
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg03040  Spliceosome
bvg04141  Protein processing in endoplasmic reticulum
bvg04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104893144
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    104893144
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    104893144
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bvg01009]
    104893144
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bvg03041]
    104893144
   03009 Ribosome biogenesis [BR:bvg03009]
    104893144
   03110 Chaperones and folding catalysts [BR:bvg03110]
    104893144
   04131 Membrane trafficking [BR:bvg04131]
    104893144
   03051 Proteasome [BR:bvg03051]
    104893144
   03029 Mitochondrial biogenesis [BR:bvg03029]
    104893144
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvg04147]
    104893144
Protein phosphatases and associated proteins [BR:bvg01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     104893144
Spliceosome [BR:bvg03041]
 Complex B
  Other components
   Prp19 complex
    104893144
 Complex C
   Prp19-CDC5 complex
    104893144
Ribosome biogenesis [BR:bvg03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    104893144
Chaperones and folding catalysts [BR:bvg03110]
 Heat shock proteins
  HSP70 / DNAK
   104893144
Membrane trafficking [BR:bvg04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    104893144
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    104893144
Proteasome [BR:bvg03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    104893144
Mitochondrial biogenesis [BR:bvg03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    104893144
Exosome [BR:bvg04147]
 Exosomal proteins
  Proteins found in most exosomes
   104893144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl DDR Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 104893144
NCBI-ProteinID: XP_010677532
Position
1
AA seq 642 aa AA seqDB search
MGDTVKSPVIGIDLGTTYSCVATWQSGRVEVIPNDQGNRTTPSCVAFNETQRFIGDAAKN
QASINPTNTVFDAKRLIGRKFNDEALQNDIKLWPFKVVASAENDKKPMIVVTYKNEEKQF
TAEEISSMVLVKLKEVAEAYLGTTVKDAVITVPAYFNNLQRQATKDAGSIAGLNVMRIIN
EPTAAAIAYGLDKKAAGSNNGVKENVLVFDLGGGTFDASLVTIEKDVFEVKSVGGDTHLG
GEDFDNRVVQHFVAEFQRKHGKDISENPRAIGRLRAACERAKRTLSSTTATSIEIDCLSE
GIDFSSTITRARFEKMNLDLFQDCVIFIEKCLKDANMEKNDVHDVVLVGGSTRIPKVQQL
LQDLFVGKELCRNINPDEAVACGAAAYAAILTGVDYKDFLLVDVTPLSLGVEVYSGDMDV
LIPRNTPVPTRVEKMFTTPLDFMTEVSIHVYEGERPRASDNNLLGRFKLSGIPSLPKGVL
QIKVYFEIDADGILKCSAEELSTGNKNGITITEHSGKLSKEEVKKMMKDAEKYKDEDEKY
RQKMKAMNSLETYAKCMKNTLRCYGKNIRLKDKRKMGDAIEQTIRWLDWNFLLSNVEKIE
DKMKELESICEPIVANMSQSQHEVAATQASRTAPKIEIIDID
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgggagatacagtaaaatcaccggtgataggaatcgatctcgggacaacatattcatgt
gtagcaacttggcaaagtggccgagttgaagtcatccccaacgaccaaggtaaccgtacg
acgccgtcttgcgtcgctttcaatgaaactcagcgtttcattggtgatgctgccaagaac
caggcctccattaatcctaccaacactgtctttgatgcaaagagactcattggtaggaaa
ttcaacgatgaagctctacagaatgacataaaactttggccttttaaggttgttgctagt
gctgaaaacgataagaaacctatgattgtggtcacctacaagaatgaagagaaacaattc
acagctgaggagatatcttccatggtcctcgtgaaactgaaagaggttgcggaggcttat
cttggcacaactgtgaaagatgctgttattactgtcccagcctacttcaacaatttgcag
cgacaagcaactaaagatgctggatccattgcagggcttaatgtcatgcgcattatcaac
gagccaacagctgctgccattgcgtatggccttgacaaaaaggctgctggaagcaataat
ggcgtcaaagagaatgtactggtgtttgatcttggaggtggtacttttgatgcctctttg
gttactattgagaaagatgtatttgaggtcaaatcagtaggtggagatactcacctcggg
ggtgaagattttgataacagagtggttcaacactttgtagctgagtttcagaggaagcac
ggaaaagacataagtgaaaatcctagagctattgggaggttgagagctgcttgtgaaagg
gcaaagaggacgctttcttctacaactgcaacttctattgagatcgattgcctttctgaa
ggcattgatttttcttcgacaattactcgtgctcgatttgagaagatgaatttagatctg
ttccaagactgtgtaatcttcattgagaaatgtttgaaagatgccaacatggaaaagaat
gacgttcatgatgttgtacttgttggtgggtctaccagaatcccgaaagttcagcaattg
ttgcaagatctatttgttgggaaggagctttgcagaaacataaaccctgacgaggcagtt
gcttgtggtgctgcagcctatgctgcaatcttgacaggtgtagactacaaggattttcta
cttgttgatgtaactcctctatcacttggcgtcgaggtctactctggagacatggatgtc
ctaatacccagaaatactccagttccaactagggtagagaagatgtttactactcctctg
gatttcatgactgaagtgagtatccatgtgtatgaaggtgagagacctagagccagcgat
aataacttattaggtcgttttaagctttcaggaattccttctctgccaaaaggtgttctt
cagatcaaggtctacttcgagattgatgctgatggaatcttgaaatgttctgccgaggag
ttaagtactggtaataagaacggaataacaattacagaacatagtgggaaactgtcaaag
gaagaggtgaagaagatgatgaaggatgccgagaaatacaaggatgaggatgaaaagtac
agacagaagatgaaagctatgaattcattggagacctatgccaaatgcatgaagaatacg
ctcagatgttatggtaaaaacattcgacttaaggacaagcggaagatgggggatgctatc
gagcagacaattaggtggttagactggaattttcttctttctaatgttgagaagattgaa
gataagatgaaagaacttgagagcatttgtgagcctattgtagcaaatatgtcacagtca
cagcatgaagttgctgccactcaagcaagcagaactgcccccaagattgagatcattgac
attgattaa

DBGET integrated database retrieval system