KEGG   Beta vulgaris (sugar beet): 104894289Help
Entry
104894289         CDS       T03548                                 

Definition
(RefSeq) hypothetical protein
  KO
K06195  ApaG protein
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    104894289
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF525 UVR DUF4354 CBM49
Motif
Other DBs
NCBI-GeneID: 104894289
NCBI-ProteinID: XP_010678785
Position
5
AA seq 295 aa AA seqDB search
MQSLSLKVFTDFGVSARKSRYNINGLSDSELGTRRNWSCSTIKVGYCKIVACSSQRNVGG
ESSPSSSPIPGPIQGSGPGQNGLHCRTQSYALLKQQMEVAAKAEDYKEAARIRDSLRLLE
DEEPVLRLRRLLKEAIAQERFQDAATYRDELKEISPHSLLTCSSDATTLGVRVQVRSVYI
EGRSQPSKGQYFYAYRIRITNNSDHPVQLLRRHWIITDGNGKTENVWGIGVIGEQPVILP
KTGFEYSSACPLSTPSGRMEGDFEMIHIDKVESRTFNVAIAPFSLSTLGDDIDPF
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcaatcattgagtctgaaagtgttcactgattttggggtatcagcaagaaaatcaagg
tataacataaatgggttgtcggattctgagttgggtacccggagaaattggagttgctcc
accataaaagttgggtattgcaagattgtggcttgttcttcacaaaggaatgttggtggt
gagagcagcccaagttcaagcccaattcctggcccaattcaaggttcgggcccgggtcaa
aatgggcttcattgtaggacccaaagttatgccttgcttaagcagcaaatggaggtggca
gccaaggctgaggattataaagaagcggcgagaatacgtgattcattgagattgttggag
gatgaagagccagttttgcgtttgaggagacttttgaaagaggctattgcccaggagagg
tttcaggatgctgcaacatatagggatgaactcaaggagatatctccacattctcttttg
acttgttcaagtgatgctactaccctgggggtccgtgttcaagtcaggagtgtctacata
gagggacgtagtcaaccttccaaaggccagtacttttatgcatataggatcaggataacc
aacaattcagaccatccagtacaattattgaggcggcattggataattactgatggcaat
gggaaaactgagaatgtctggggtataggagttatcggtgagcagccagttatacttcca
aaaactggctttgaatactcttcagcatgcccattaagtactccgagtggaagaatggaa
ggtgattttgaaatgattcatattgacaaagtagaatcgagaacattcaatgtagcgatt
gctccattttcgctctccacactcggtgatgatattgatcctttctga

DBGET integrated database retrieval system