KEGG   Beta vulgaris (sugar beet): 104895777Help
Entry
104895777         CDS       T03548                                 

Definition
(RefSeq) pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    104895777
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bvg03041]
    104895777
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     104895777
Spliceosome [BR:bvg03041]
 Complex C
  Other components
   Step II factors
    104895777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C AAA_22 DEAD T2SSE AAA_30 AAA_19 DUF2075 AAA_24 FtsK_SpoIIIE SRP54 Peptidase_S26 ATPase TrwB_AAD_bind
Motif
Other DBs
NCBI-GeneID: 104895777
NCBI-ProteinID: XP_010680672
Position
6
AA seq 706 aa AA seqDB search
MPSMANSQFRQPNGIVSNNDSRRQKILQQRKSLPIAVVEKRLIEEVRNNHTLIIVGETGS
GKTTQLPQFLLKAGFCRQEKLIGVTQPRRVAAVTVAKRVAEECGVQLGQKVGYSVRFDDM
TSGSTRIKYMTDGLLLREALLDPYLSKYSVIVVDEAHERTVHTDVLLGLLKNVQKARSQT
ANELVDQIKINNDTKLEKDNGTQMASPLKQCQGAKLPPLRLIIMSASLDARIFSEYFGGA
KAVHVQGRQFPVDIFYTLHAETDYVEAAMVSIFQIHLEEALGDILVFLTGQEEIESVEGL
VRDKLPQLPESSRNIVTVPIYASLPSEQQMKAFMPAPAGSRKVILATNIAETSVTIPGIK
YVIDPGVVKARNYNPRTGIESLNIIPTSKAQALQRSGRAGREGPGKCFRLYTEREFEKLA
DSTVPEIKRCNLSNVILQLKALGVDDIIGFDFMEKPSRMAIVKSLEELFLLGALTEDYKL
SDPIGLQMARLPLDPIYSKALILSSQFNCLEEMLIAVAMLSVESIFFTPREKQEEARTAI
RRFSSPEGDHITMINVYKSCDEFLESGNAKSSKEKTFKSMKKWCKENFVNGRSLRHARDV
HCQIRGHVEQMGLRIASCGGDMLLFRRCLAASFFLNAALKQPDGTYRALASSQMVQIHPT
SVLFRAKPDCIIFNELVRTNQNYIRDVTRIDPMWLTELAPHFYAAQ
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgccgtcaatggctaattcacaatttaggcaacccaacggcatcgtttcgaacaatgat
tccaggaggcaaaagattttgcagcaacgaaaatctcttccaattgctgttgttgagaaa
cgactaattgaagaggttcgcaataatcacactctgattattgttggtgaaactggaagc
ggcaaaactactcaattacctcagtttttgttaaaagccggcttctgccgtcaggaaaaa
ttgattggggttactcaacctaggcgtgttgctgctgtcactgtggctaaaagagtagct
gaggaatgtggtgtgcaattagggcaaaaggtaggatattcagttcgattcgatgacatg
acttctggatcaacgaggatcaagtacatgacagatggattattattaagggaagcatta
ttggacccatacctatctaaatattcagttattgttgttgatgaagctcatgagagaact
gttcacactgatgtgttactgggcctgctgaaaaatgttcagaaagctagatctcaaact
gcaaacgagttagttgatcaaatcaagataaataatgacacaaagttggagaaagataat
gggactcaaatggcctccccgctcaagcaatgccaaggtgcaaaacttcctcctctaagg
ctgataataatgtctgccagcttggacgcacgtatattctctgagtactttggtggtgca
aaggctgttcatgttcagggaagacaatttcctgttgatatattttatactctccatgct
gagacagattatgttgaggcagcaatggtgtcaatatttcagattcatttggaggaggct
cttggtgatatacttgtatttttgactggtcaagaagagattgaatctgtagaggggctt
gtgagagacaaattgccacaattacctgaaagcagtcggaatattgtgaccgtccctatt
tatgcatctcttccctcagaacagcaaatgaaagcttttatgcctgcgccagctggatct
cgtaaggtaatactggcaacaaacattgctgagacatcggtgaccataccaggaatcaaa
tatgttatagaccctggagtggtgaaagcccgcaactataatccacgtacagggatagaa
tcactaaacattattcctacttcaaaagcacaggctcttcaaaggagtggacgtgcaggg
cgtgaaggacctggaaaatgcttccgcctttacacagagagagaatttgagaaacttgcg
gattccacagttccagaaattaagcgttgcaatctctcaaatgtcattttgcagctgaaa
gctcttggtgttgacgatattattggctttgacttcatggaaaaaccttcacggatggca
attgtgaagtctctggaagaactattcttgcttggtgctctaacagaggattataagctt
tcagatcctattgggcttcagatggctaggcttccattagatcctatatattctaaggct
ctcattctatctagtcaattcaactgcctggaggaaatgttgatagcagtcgcaatgctc
tctgttgaatcaattttttttacaccacgtgaaaagcaagaagaggctaggactgcaata
agacgattttcaagccctgagggggaccacataaccatgattaatgtgtataaatcatgt
gatgagtttttggagagcggcaatgcaaaaagcagcaaggaaaaaacatttaagagtatg
aagaaatggtgcaaagaaaattttgtaaatggtcgctcattgaggcatgctcgtgatgta
cactgccaaatccgaggccatgttgaacaaatgggccttcgtattgcttcatgtggaggg
gatatgcttctatttcgcagatgccttgcagcttcctttttcctcaatgctgccttgaaa
cagcctgatggtacctatagggccttggcaagcagtcaaatggtgcaaatccaccctact
tctgtgttgtttcgggcaaaaccagactgcataatattcaatgaacttgttagaactaac
cagaactatatccgcgacgtaactaggatcgatccgatgtggttgacagaactggctcct
catttttatgccgcacagtaa

DBGET integrated database retrieval system