KEGG   Beta vulgaris (sugar beet): 104896997Help
Entry
104896997         CDS       T03548                                 

Definition
(RefSeq) methionine S-methyltransferase
  KO
K08247  methionine S-methyltransferase [EC:2.1.1.12]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00450  Selenocompound metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104896997
Enzymes [BR:bvg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.12  methionine S-methyltransferase
     104896997
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2 Methyltransf_31 MTS PrmA Methyltransf_25 Methyltransf_12 Met_10 Methyltransf_11 Methyltransf_4 Methyltransf_23 Methyltransf_32
Motif
Other DBs
NCBI-GeneID: 104896997
NCBI-ProteinID: XP_010682098
Position
6
AA seq 1076 aa AA seqDB search
MECVEEFLKKCKQSGDAAYSELRSVLEKLENPETRVEARIFLSHVQKHFDSITDDCFSTY
HFRINDIQLEHSSGSQHRKKLTMLVIPSIFMPEDWSFTFYEGLNRHPESIYKDKIVAELG
CGNGWITIAIAEKWSPLKVYGLDINPRAIKVSWINLYLNALDENGQPIYDGEKKTLLDIV
EFHESDLLAYCRDHNIMLERIVGCIPQILNPNPDAMSKLITENASEEFLHSLSNYCALQG
FVEDQFGLGLIARAVEEGIAVIKPTGIMIFNMGGRPGQAVCRRLFERRGFHVNKIWQTKV
VQAADTDISALVEIEKNSPHRFEFFMGLTGDQPICARTAWAYGKAGGCMSHSISVYSCQL
RQPNQVKRVFEFLRDGFNEINNSLDLSFDNDAVADEKIPFLAYLGSVLQENSYLPFESPA
GSRRFRDLVARFMKTYHHVPLTAKNVVVFPSRTAAIENALRLFSPNLAIVDELLTRNLPR
QWMTSLAIEKRDCSEASDVVTVIEAPHQSDLMVELIKKLKPQVVVTGIAKFEAVTSAAFE
NMLDVTRKIGSRLFLDISDHFELSSVPSSNGVLKYLAGNSLPSHAAIVCGLLKNQVYTDL
EVAFVISEDATIFQALARTVELLEGNTSLISQNYYGCLFHELLSFQLADRHPLATREYDE
KSSTKLIGFASSAISVFSDSELSISEGDNDSSLIHMDVDQSFLPLPAPIKTAIFGSFARQ
NLSESETDVTSGVRQFIKTRYGFATNNSTEFLYSDYSLGLFNKMLLCCIQEGGTFCFPAA
CNGNYIAAAKFMKANIVNIPTKADVRFKLTDDVLTKVLESVEKPWLYICGPTINPTGLLY
SNKEMENILSVCAKFGARVLIDASFSGLEYDTDNWDAWNLEPTLAKLYSSANPTFCVSLL
GGLSLEMLTGGLTFAFLAVDHCLLTETTNGFAGLTRPHSTTRYAMKKLLAQAEQESGNLS
EFVTEHKEILKNRSHRLKETLQNCGWEVLPSCGGVSMVARPSAYLGKHIKLENATSQKIE
IADSTIRQAILDATGLCINSGLWTGIPGYCRFTIALQEDEFEHALDRITKFKDFMG
NT seq 3231 nt NT seq  +upstreamnt  +downstreamnt
atggaatgcgtagaggagttcttgaagaaatgcaaacaatcaggagatgcagcgtacagt
gaactacgatcagtgttagaaaagcttgaaaatcctgaaactagagttgaagcacgaata
ttcttatctcatgttcagaaacatttcgattctattactgatgattgcttttctacttat
catttccgaatcaatgacattcaattggagcattcttcaggctcccagcacaggaaaaag
ttgacaatgctggtgattcctagcatttttatgccagaagattggtctttcacattctat
gaaggattgaacagacatcctgaatccatctacaaggataagatagttgctgagcttggt
tgtggaaatggatggataactattgctatagctgagaagtggtctcctttgaaggtgtat
gggcttgatataaacccgagagctataaaggtttcctggattaacctttacttaaatgct
ttggatgagaatggtcaacccatttatgatggtgagaagaagactctactggatatagtg
gaatttcatgaatctgaccttctagcttactgtagagaccataacataatgcttgaaagg
attgttggctgcataccacagatccttaatcctaatccagatgcaatgtccaagcttatt
acggaaaatgcaagtgaggagtttctccattctctcagcaactattgtgcactgcagggt
tttgttgaagatcaattcggcttaggcttaatagctagggcggttgaagagggcattgca
gttattaaacccactgggattatgatttttaatatgggaggtcgtccaggacaagctgtt
tgcagacgtttgtttgaacggcgtggtttccatgttaacaagatctggcaaacgaaagtt
gttcaggctgctgatacagatatttcagcgttagttgagattgaaaagaacagtccacac
cgttttgaattcttcatggggcttacaggagatcaacctatttgtgcacgaacagcttgg
gcgtatgggaaggctggtggttgtatgtctcattctatttcggtttacagttgtcaactt
cgtcaacctaatcaagttaagagagtttttgagtttctgagagatggctttaatgagatc
aacaattctttggacttatcctttgacaatgatgctgttgctgatgaaaagattccattc
ctggcgtatcttggaagtgttctccaagaaaattcatacctcccttttgagtcaccagct
ggcagtagacgctttcgagaccttgtagcaaggttcatgaaaacttaccatcatgttcca
cttactgccaagaatgtagttgtatttccttcaaggactgcagcaattgagaatgcttta
cggctgttctcacccaatcttgccattgtcgatgagcttttgacccgaaaccttcctagg
caatggatgacatctttggcaattgagaagagagattgtagcgaggcttcagatgtggtt
acagttatagaggctccacatcagtcagatttgatggttgagctgattaagaagctgaaa
cctcaagttgtggttactggcattgctaaatttgaggctgttactagtgctgccttcgag
aatatgttggatgttacaagaaaaattggctcacgtcttttcttggacatatctgaccac
tttgagttgtcaagcgtgcctagctccaacggggtcctgaagtatcttgcaggaaattct
cttccatcacatgctgccattgtgtgtggtctgttaaagaatcaggtttatacggacctt
gaagtagcatttgtgatttcagaagatgcaacaatttttcaggctctcgcaagaactgtc
gaacttcttgaagggaatacttcattgattagtcaaaactattatgggtgtcttttccat
gagcttctctcctttcagttagctgatcggcatccacttgcaacgagagaatatgatgag
aagagttccaccaagttgattggatttgccagctctgctatatccgtcttcagcgattcc
gagctttcaataagtgaaggagacaacgattcttccctgattcacatggacgtcgatcaa
agctttttgccattgcctgcacctataaagactgctatttttggaagttttgctaggcag
aatctctcggagtctgagacagatgtgacaagcggcgtcagacaattcattaagaccaga
tatgggttcgcaacaaacaatagcacagaatttttatactctgactattctttgggtctt
tttaacaagatgctgctttgctgtattcaagaaggtggcacattttgttttcctgctgca
tgtaatgggaactatatagctgctgcaaagtttatgaaagcaaacattgttaacattccc
acaaaggctgatgttcggtttaagttaactgatgatgtattgaccaaggtgctggagtct
gttgaaaagccatggctgtatatttgtggtcctacaataaaccctactggattgctttac
agcaacaaggagatggaaaatatattatcagtctgtgcgaaattcggtgcaagggttctg
attgacgcctctttctcaggactagaatatgacaccgacaattgggatgcctggaatttg
gagcccactttagcaaagctatattcctctgccaacccaacattctgtgtttctctgctt
ggaggtctctcactagagatgcttactggtgggctgacatttgcattcttggcggtggat
cactgtcttttaactgagacaaccaatgggtttgctggtctaactagacctcacagtact
actagatatgctatgaagaagttgttggctcaggctgaacaagaatctggtaacctttct
gaatttgttactgaacacaaggagattttgaaaaataggtcacatcgcttgaaggagaca
ctgcaaaattgtggatgggaagtgcttccatcctgtggtggtgtgtccatggtggcaaga
ccatctgcttatcttgggaagcatatcaaactcgagaatgctaccagtcaaaagattgag
attgcggactctaccattcgacaagccattttggacgccactggtctatgcatcaatagt
gggttatggactggaattcctggttactgtcgcttcacaatcgctttacaagaagatgaa
tttgagcatgcattggatcgcattacaaaattcaaggatttcatgggttaa

DBGET integrated database retrieval system