KEGG   Beta vulgaris (sugar beet): 104898491
Entry
104898491         CDS       T03548                                 

Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00100  Steroid biosynthesis
bvg01100  Metabolic pathways
bvg01110  Biosynthesis of secondary metabolites
Module
bvg_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    104898491
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     104898491
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 104898491
NCBI-ProteinID: XP_010683881
Position
7
AA seq 365 aa
MDLHLFIPSWTSVGLLLSYFGYLAIFGSLLPGKIVSGVTLADGTRLHYRCNGLLSLTLLV
LLLGGGVAAGFVSPTAIADRGLELLSATFIFSFVVTLLLYIVGSTSRDQGSSLKPHVSGN
LIHDWWLGIQLNPHFMGIDLKFFFVRAGMLGWLLINLSLLAKNIQDGHFDRSMALYQLFC
SFYILDYFFYEEYMTSTWDIIAERLGFMLVFGDLVWIPFTFSIQGWWLLRNNVELTTAAV
VANCIAFLMGYRIFRGANKQKHVFKKNPKAPIWGKPPKVIGGKLLASGYWRIARHCNYLG
DLLLALSFSLPCGISSPIPYFYPTYLLILLIWRERRDEARCAEKYKDIWAEYRKLVPWRI
LPYVY
NT seq 1098 nt   +upstreamnt  +downstreamnt
atggatctacacctcttcatcccttcttggacctctgtgggtttattgctctcatatttt
ggttacttggccatttttgggtctcttctacctggcaagattgtttctggcgttacttta
gccgatggcactcgcctccattaccgatgcaacggcctgttatcacttactttgctggtt
ttgcttcttggtggtggagttgctgctggatttgtatcacccacagcaattgcagacaga
ggacttgagcttttatctgcgactttcattttcagtttcgttgtaactttgttactttac
attgtgggtagcacttcgcgtgaccaaggttcatcactgaagccccatgtctctggaaat
ttgattcatgactggtggcttgggatacagctgaatcctcattttatgggcattgatctc
aaattcttttttgtgagagctggaatgttgggatggttacttattaatctttcacttttg
gctaaaaacatccaagacggccactttgatcgttcgatggctctataccagttattttgc
tctttttacatactagactacttcttctatgaagaatacatgacttctacttgggacata
attgcggagagattgggctttatgttggtgtttggggatcttgtctggattcctttcaca
tttagcatccagggttggtggcttctgagaaacaatgtggagctaacaactgctgcagtc
gtggcaaattgcattgccttcctaatggggtaccgcatctttaggggcgctaacaagcag
aagcacgtgtttaagaagaaccccaaagcacctatatggggtaaacctccaaaggtcatt
gggggtaaattgcttgcttctggctattggagaatcgctagacactgtaactatctagga
gacttgttattggcactgtccttcagtctaccttgtggaattagctcgcctatcccttac
ttttatcctacatatcttcttatattgctgatatggagagaaagaagggatgaagctcga
tgtgcagagaagtacaaagacatttgggctgagtatcgtaaacttgtgccctggagaata
ttgccatatgtttattag

DBGET integrated database retrieval system