KEGG   Beta vulgaris (sugar beet): 104899694Help
Entry
104899694         CDS       T03548                                 

Definition
(RefSeq) polyamine oxidase
  KO
K13366  polyamine oxidase [EC:1.5.3.14 1.5.3.16 1.5.3.-]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00330  Arginine and proline metabolism
bvg00410  beta-Alanine metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    104899694
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    104899694
Enzymes [BR:bvg01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.14  polyamine oxidase (propane-1,3-diamine-forming)
     104899694
    1.5.3.16  spermine oxidase
     104899694
    1.5.3.-  
     104899694
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 Pyr_redox_3 Pyr_redox_2 DAO FAD_binding_3 FAD_binding_2 Lycopene_cycl Thi4 HI0933_like GIDA Shikimate_DH FAD_oxidored DinI Pyr_redox
Motif
Other DBs
NCBI-GeneID: 104899694
NCBI-ProteinID: XP_010685235
Position
7
AA seq 490 aa AA seqDB search
MKGLSTMKLFLLFPLLLATIEYASSSSPSVIIIGAGMSGISAAKRLEDAGIKDFVILEAT
NRIGGRIKKTEFAGYTVEMGANWLHGVGGRMRNPLYEMSKQIHLKKFYSDFSNISSNTYK
QEGGLYKKDEVDAAINKVDKTIEDGVKYSNILNSEKDGNDNNDMSILAFERLYKREPRTK
LERAVDFFNFDAEQGQAPRVTSLKHVLPFPEGHYYGENSYFVADSRGFESLVHLIAKQFL
SYKNGVVNDPRVKFNQVVNKIEQSKNGVLVRTEDGKKYQANLVIVSASLGVLQSDLISFK
PQLPLWKRRAISEFSIGIYTKIFLKFPRTFWPVANGTEFSLYVHERRGYYTYWQRLHNEY
PESHLMLVTVEDDESIRVEQQSDEETKAEIMEVLRKMFGKDIPEATHILIPRWKSDRFYQ
GSYSNWPVGYSQKRHDQLKAPVGQVYFTGEHTHSTFFGYASGAYFAGINTAREVINCLKN
KRFCRGVRHG
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaagggattaagcacaatgaagctattcttgctcttcccccttttgttagccaccatc
gagtatgcttcatcttcatccccctccgtcatcattatcggtgccggaatgtcaggtatc
tcggcagcaaaaagacttgaagatgctgggattaaggattttgtaatactagaggcaacg
aatagaattggtgggagaattaagaagactgaatttgcaggctatacagttgaaatgggt
gctaattggcttcatggagttggaggtcgcatgagaaatcctctctatgagatgtccaag
caaatccaccttaagaaattctactccgattttagcaatatctcttcgaacacctataaa
caagagggtggattgtacaaaaaagatgaggtggatgcagctattaataaagtcgacaaa
acaattgaagatggagtgaagtattcaaatattttaaattcagagaaggatggtaatgat
aataatgatatgtctattttggcttttgaacgtctttataaaagggaaccaagaacgaag
ctagaaagagcggtagacttcttcaactttgatgcagaacaagggcaggcacccagagtt
actagcttgaagcatgttctaccatttcctgagggccattattatggtgaaaattcttac
tttgtagcagattcaagaggctttgagagtttggttcatcttattgccaaacaatttctc
tcttataagaatggtgtagtcaacgatcctagggtcaagtttaatcaggtagtaaataag
attgaacaatcaaaaaatggtgtattggtaaggacagaggatggcaagaaataccaagcc
aacctcgttattgtgtctgctagccttggtgtcttacaaagtgaccttatcagcttcaaa
cctcaacttccattatggaaaaggcgtgcaatatcagaattcagcataggaatttatacc
aaaatcttcctcaagttccctcgtacattttggcctgtagccaatggcaccgaattttcc
ttgtatgttcatgaaagacgaggatattatacctattggcagcgcttgcacaatgagtat
cccgaatcacaccttatgctagttacagtggaagatgatgagtctataagagtagaacaa
caatctgatgaagaaacaaaagcagaaataatggaagttttgagaaaaatgtttggaaaa
gacattccagaagctacacatatactaattcctagatggaaatcagatagattctatcaa
ggttcctactcaaattggcctgttggctattctcaaaaacgccatgaccaattaaaggct
ccagttggtcaagtatacttcacaggagaacatacacacagtacattttttggatatgca
agtggtgcatactttgcaggtatcaatacagcaagggaagtaattaactgcttgaagaat
aaaagattttgcagaggtgtccgccacggataa

DBGET integrated database retrieval system