KEGG   Beta vulgaris (sugar beet): 104899808Help
Entry
104899808         CDS       T03548                                 

Definition
(RefSeq) beta-fructofuranosidase, cell wall isozyme-like
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00052  Galactose metabolism
bvg00500  Starch and sucrose metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    104899808
   00500 Starch and sucrose metabolism
    104899808
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     104899808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 104899808
NCBI-ProteinID: XP_010685380
Position
7
AA seq 584 aa AA seqDB search
MPLFYNIKVVTTFLFASLFFGYGVIELQASHHVSNHLQDVATSQSLFSDDQPYRTAYHFQ
PLKNWMNDPCGPMIYKGIYHLFYQYNPIGNGSPDGPRVWGHSTSLDLINWTPQPLTLLLQ
LEANMNSSWTGSITILQDYKPAILFTGITPKNEQVQDLAFPKDLSDPYLKEWILVPQNPV
MSPTQENKINATSFRDPTTAWRLPDGSWRVVIGSKIERRGLALLFRSKDFINWVQADHPL
YSYELTGMWECPDFFPVNVNGIPIGVETSAIGPNVKHVLKLSLDDTKHDIYTIGTYDVFK
DAYIPDVGFQNDSSLRYDYGKYYASKTFYDSSKMQRLLLSWVNESSSLADDIKKGWSGIH
AVPRRVWLDISGKQLIQWPIPEIESLRVNPVILPIQLIKGGSVIEIPGISAAQADVELSF
GLRDLSNIEKFEASWTNPQLLCSQKGALVSGGLGPFGLLTLASMGLEEYTAVFFRIFKDY
DNDKFVVLMCSDQSRSSLNPTTDKTTYGTFVNVNPIYEGLSLRILIDHSVIESFGGKGKN
VITARVYPTLATNDKARLYVFNYGRGSVQITWLTAWSMKKANIA
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgcctttgttttacaacataaaggtagtgaccacttttttgtttgcttcacttttcttt
ggctatggtgtaattgagctccaagcctcccaccatgtctccaaccaccttcaagatgtc
gcgacttctcagtctcttttttcagatgatcagccttaccgaactgcctaccattttcaa
cccttaaaaaattggatgaacgatccgtgtggcccaatgatatacaaaggaatttatcac
ctattttatcaatacaacccaataggtaatggatcaccagatggtcctcgagtatggggc
cattcaacatcattagatctaatcaattggactccacaaccattaactctcctactacaa
ttggaagccaacatgaatagtagttggactggatcaatcactatacttcaagattataaa
cctgcaattctatttactggaattactccaaaaaatgaacaagttcaagatttagcattt
cctaaagatttatctgacccatatttaaaagaatggattttagtacctcaaaatccggtt
atgtctccaacccaagaaaataaaataaatgccacctcatttagggacccgacgacggct
tggcggttgccagatggcagttggagagtggttattggaagcaagatagaaagacgtgga
ttggctttattatttagaagtaaagattttattaattgggttcaagctgaccatccgtta
tattcatatgaacttacgggtatgtgggagtgtccagattttttcccagttaatgttaat
ggaattccaattggtgttgaaacttctgcaattggtcctaatgttaagcatgtgcttaag
cttagtttggatgatactaagcatgatatttacacaattgggacgtatgatgttttcaag
gatgcttatattcctgatgtgggttttcagaatgactcaagtttaaggtatgattatggg
aaatattatgcttctaaaacgttttatgatagttcaaagatgcaaaggttattgctcagt
tgggttaatgagtcatcgagtttggctgatgatattaagaagggatggtccggaattcat
gctgttccaagaagagtttggcttgacatatcagggaagcagttaattcaatggccaatt
ccagaaattgaaagcttgagagtaaatccagtaattttacctattcaactaatcaaagga
ggatcagtaattgagattcccggcattagtgctgcacaagcagatgtagaattgtcattt
gggcttagagatttgtcgaatattgagaagtttgaagcaagttggaccaacccacaattg
ctttgcagccaaaagggtgccttagtcagtggtgggcttggcccatttgggttactcact
ttagcttcaatgggccttgaagagtatacagcagttttcttcagaatttttaaagactat
gacaatgataaatttgttgttttaatgtgcagtgatcagagcaggtcttctttgaatcca
acaacagataagacaacatatggaacttttgtgaatgtgaatcctatttatgaagggttg
tctttaagaattttgattgatcactctgtaatagaaagctttggagggaaaggaaaaaat
gtgattaccgcaagggtgtatcccacattggcaacgaatgataaggcccgtctctatgtc
tttaactacgggagagggagcgttcaaattacctggttaactgcttggtctatgaagaaa
gctaatatcgcttag

DBGET integrated database retrieval system