KEGG   Beta vulgaris (sugar beet): 104902608Help
Entry
104902608         CDS       T03548                                 

Definition
(RefSeq) protein IWS1 homolog 1
  KO
K17498  transcription factor SPN1
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:bvg03021]
    104902608
Transcription machinery [BR:bvg03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     104902608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Med26
Motif
Other DBs
NCBI-GeneID: 104902608
NCBI-ProteinID: XP_010688740
Position
9
AA seq 516 aa AA seqDB search
MAFDDPYRDEDGEPLMDYDDIQSDDDQVQLPPNDDVQDFNDVDDDDEEGGGNGNWNQEPK
AKTRKRLIKKSDDHSSMPPEFNDFADEDDVGEPEYGSFPEEEEEEEPSPSISKKRKDKGM
MKEGGEKRRKEKKLRKDKYSSSAGGSDGGKGKLSLRRKKGNDEGDPEMKEMWDTIAGGDS
EDDQEGMKTLDDDNFIDDTGVDPADMYNDREAASPSRFDQAEEGEEDDEMRDLFKGGKKK
KKNEKSAAEIAELVETLMAELEVVAEEDAVLNTQGKPAINKLRKLPLLTQALSKKQLQHE
FLDHGVLTLLKNWLEPLPDGSLPNINIREAILRILTDFPIDLDQYDRREQLKKSGLGKVI
MFLSRSDEETTSNRKLAKDLVDKWSRPIFNKSTRFEDMRNVEEERVYRRPPVKKPANKSS
GLESKDDDLEFSSGRKAGPSASRQHASRPEATPMDFLIRPQSKIDPDEIRARAKQQQQDE
RRMKMNKKMQQLKQMKKKKLQATSVSVEGRGMVKYL
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcgatgatccgtaccgtgacgaggatggagagccattgatggactatgacgac
atccaatcagacgacgatcaggtgcagttgcctccaaacgacgacgttcaagacttcaac
gacgtggatgatgatgatgaagaaggaggaggcaatgggaattggaaccaggagccgaaa
gcgaaaacccgaaagcggcttattaagaagagtgatgatcattcttctatgccacctgaa
tttaatgattttgctgatgaagatgatgttggtgaacctgagtatggttcattccctgag
gaagaggaggaggaggaaccgtctccatcgatatcgaagaagaggaaggataaagggatg
atgaaggagggaggagagaagaggaggaaagagaagaagttgaggaaagataagtatagt
agttctgctggtggtagtgatggtgggaaggggaaattgagcttaaggcgaaagaagggc
aacgatgagggcgatcccgagatgaaggagatgtgggatactattgctggtggtgattct
gaggatgatcaagagggtatgaagacattagatgatgacaattttatagatgacactggg
gtggaccctgctgacatgtataatgatcgcgaggcagcttctcccagccgttttgaccag
gcagaggagggtgaggaagatgatgaaatgagggatcttttcaaagggggcaagaagaag
aagaagaatgagaaaagtgctgcagaaattgcagagttggtggagacccttatggctgag
cttgaagttgtagctgaagaagatgctgtattaaatacacaggggaaaccagccatcaat
aagctcaggaagttgccacttcttacacaggctctttccaagaaacaacttcaacatgaa
tttctggatcacggggtcttaacgttgttaaaaaattggctggagccacttcctgatgga
agcctacccaatatcaatatacgtgaagctatattaaggatcttaactgattttcctatt
gatttggaccaatatgatcgaagagaacaattgaagaagagtggacttggaaaggtcatt
atgtttttatccaggtcagatgaagagacaacatcaaataggaaacttgccaaggatttg
gttgataaatggagccgtccaattttcaataagagcactaggtttgaggatatgagaaat
gttgaggaggaaagagtttacaggcgaccaccagtgaaaaaaccggcaaataaatcctca
gggctggaatctaaagacgatgatcttgagttttcatcgggacggaaggctggcccatct
gcttctaggcaacatgcgtccaggccagaagcaactcccatggattttctgattcgccct
caatccaagattgaccctgacgagatacgagcacgagctaaacaacagcaacaggatgaa
cgtcgtatgaagatgaacaaaaagatgcaacaactaaagcagatgaaaaagaagaagctt
caagctacaagtgtcagtgtggagggtcggggcatggtgaaatacttatga

DBGET integrated database retrieval system