KEGG   Beta vulgaris (sugar beet): 104905390Help
Entry
104905390         CDS       T03548                                 

Definition
(RefSeq) UDP-glucuronate 4-epimerase 3
  KO
K08679  UDP-glucuronate 4-epimerase [EC:5.1.3.6]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00520  Amino sugar and nucleotide sugar metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    104905390
Enzymes [BR:bvg01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.6  UDP-glucuronate 4-epimerase
     104905390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA adh_short KR
Motif
Other DBs
NCBI-GeneID: 104905390
NCBI-ProteinID: XP_010692224
Position
1
AA seq 450 aa AA seqDB search
MKEMAHIDNSPSTPGKFKMEKSGYNIHHQYHHRLRWPVAKLTFWCCIFVGLILVFMLRSS
SSSSYSASDYRDKDSISTRHSRSLRTFSWGGPSWEKRVRNSGRVRAPNGFSVLVTGAAGF
VGTHVSAALKRRGDGVLGLDNFNDYYDPSLKRARQALLDRSGVFIVQGDINDEPLLKKLF
QLVPFTHVMHLAAQAGVRYAMQNPSSYIHSNIAGFVNLLEVCKSVNPQPSIVWASSSSVY
GLNSKVPFSEKDRTDQPASLYAATKKAGEEIAHTYNHIYGLSLTALRFFTVYGPWGRPDM
AYFFFTKDILKGKSIPIFEAANHGTVARDFTYIDDIVKGCLGALDTAQKSTGSGGKKKGP
AQLRVFNLGNTSPVPVSDLVSILESLLKVKAKRTVMKLPRNGDVQYTHANISYAKRELGY
KPTTDLQGGLKKFVRWYLNYYKPGGKKSSV
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaatggctcacatagacaactccccatcaacaccaggaaagttcaaaatggag
aaatctggttacaacattcaccaccaataccatcatcgtttaagatggcctgttgcaaaa
cttacattttggtgttgcattttcgttggattaattctagtatttatgttgagatcatca
tcttcttcttcgtattcagcctcagattatagagataaagatagtattagtactcgtcat
tcccgttccctccgcacattctcatggggcggcccctcatgggagaagcgcgttcgaaac
tcaggtcgagttcgagctcccaacggtttctctgtgctagtcaccggtgctgctggtttt
gttggcacccacgtctcagccgcattgaagagacgaggtgatggtgttttaggattggat
aatttcaatgattactatgatccttcattaaaaagagctagacaagctcttcttgataga
agtggtgtttttattgtccaaggtgatataaatgatgaacctcttttaaaaaagttattt
caacttgttccttttactcatgttatgcatttagctgctcaagctggtgttagatatgct
atgcaaaatccttcttcttatattcatagtaatattgctggttttgttaatttgcttgaa
gtttgtaaatctgttaatcctcaaccttcaatagtttgggcatcatctagttctgtttat
gggttgaattctaaagttccattttctgaaaaagataggactgatcaacctgctagttta
tatgctgctactaagaaagctggtgaagagattgctcatacatataatcatatatatggt
ctttcacttactgccttaagattctttactgtatatggtccttggggtagaccagatatg
gcttactttttctttactaaggatatattgaagggaaaatccataccaatctttgaggct
gcgaatcatggcaccgttgctcgtgattttacctacattgatgatattgtcaaaggttgt
ttaggggctttggatactgctcagaagagtactggtagtgggggtaaaaagaagggtcct
gctcaattaagggtcttcaatttggggaatacgtcgcctgttcctgtttccgatcttgtt
tccatattggagtctctcttgaaggtaaaggctaagaggacagtcatgaagttgcctagg
aatggtgatgtgcagtatacgcacgccaacattagctatgctaagagggagcttgggtat
aagcccaccacagatctgcaaggcggcttgaagaagtttgttagatggtacctcaattat
tataaaccaggagggaagaagagctctgtgtga

DBGET integrated database retrieval system