KEGG   Beta vulgaris (sugar beet): 104905408Help
Entry
104905408         CDS       T03548                                 

Definition
(RefSeq) glutathione S-transferase 2
  KO
K01800  maleylacetoacetate isomerase [EC:5.2.1.2]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00350  Tyrosine metabolism
bvg01100  Metabolic pathways
Module
bvg_M00044  Tyrosine degradation, tyrosine => homogentisate
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    104905408
Enzymes [BR:bvg01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.2  maleylacetoacetate isomerase
     104905408
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 GST_C Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 104905408
NCBI-ProteinID: XP_010692254
Position
1
AA seq 232 aa AA seqDB search
MKTAAASSTSSTSSRVLYSFWLSFCAWRVRFALNMKGLQYEYKSVDLFKGEQFHPEFEQI
NPLRYVPVLVDDGVVVSDSLAILMYLEDRYPENPLLPADPCRRALNLQAASIVSCSMQSL
HMRSVLEFIENKLGQEERTTWVQMIIDKGFSALEKLLKDYAGRYSTGDEVSMADVFLAPQ
ISAAVSRFNTDMSKYPTLRRVYEACEVLPEFQASIPERQPDAVNAERDWFSR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagctgctgcatcatccacatcttcaacttcaagtagggtgctttactctttc
tggctaagtttttgtgcttggcgtgttcgttttgctttaaacatgaaagggcttcaatac
gagtataaatcagttgatctcttcaaaggggagcaatttcatccagaatttgaacagatc
aacccgcttcgttatgttccagttcttgttgatgacggggttgtggtttctgactcgctg
gctatccttatgtatctagaagataggtatcccgaaaatccacttttgccagctgatcct
tgcagacgagcgctcaatcttcaggctgcaagtatcgtcagttgcagcatgcagtcactt
catatgagatcagtgctggagtttattgagaataaacttggtcaagaggagcgtacaaca
tgggttcaaatgattatcgataagggtttctctgctctggaaaagttgctcaaagattat
gctggcagatattctaccggagatgaagtatctatggcagatgtatttctggcaccacaa
atttctgctgcagtgagcagatttaacaccgatatgtcgaaatatcccaccttacggagg
gtgtatgaagcatgcgaagtgttgcctgaattccaagcctctattcctgagaggcaaccg
gatgcagtcaatgcagaaagagattggttcagccgttag

DBGET integrated database retrieval system