KEGG   Beta vulgaris (sugar beet): 104905971Help
Entry
104905971         CDS       T03548                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00010  Glycolysis / Gluconeogenesis
bvg00562  Inositol phosphate metabolism
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104905971
   00562 Inositol phosphate metabolism
    104905971
Enzymes [BR:bvg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     104905971
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     104905971
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 104905971
NCBI-ProteinID: XP_010692944
UniProt: A0A0J8BDP8
Position
2
AA seq 513 aa AA seqDB search
MEVKVKMKGKLIVIFMLHAIFSLLILLLLLPSSFSARLIVDEPFDVRQHLSTVSRYGVVK
DLVDNSFVPANIPDTCTPIHLNLVARHGTRAPTKKRMKEMERLAISLQALIEDAKERKLS
LDNVPAWLFDWTSPWKGKVKGGELIVKGEDELYDLGIRIREKFPDLLNDEYHPDVYTIKA
TQVPRASASAVAFAMGLFSGRGSLGPGKHRAFAVSTESRASDLLLRFFDTCQSYKNYRKS
EEPAVEKLKEPIFDEITHALSGRSGLNFTRQDISSLWFLCKQEASLLDITNQACGLFNPT
ELALLEWTDDLEVFVLKGYGKSVNYKMGLPLLKDVVESMELAVKSNEEALPSGSYEKARL
RFAHAETVVPFSCLLGLFLQGSEYNLILKEKPLELPPKPPKRRAWRGSAVAPFAGNNMLV
LYSCPARKSSKYFVQVLHNEHPVPLPGCDNSDFCPFEVFKERILEPHMKHDYHAICRVKE
EAAPVAASSKLSSLFFWLFSWHSEGKESDNVDL
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atggaagtgaaagtaaagatgaaagggaaattgatcgtcatttttatgctacatgctatt
ttctctctcctcatattactattacttctaccttcttctttttctgctcgtttaatcgtc
gatgaaccttttgatgttcgccagcatctctccaccgtttccagatatggagttgtgaaa
gatttggtggataattcatttgtaccggcgaatatacctgatacttgtacaccaattcat
cttaatcttgtggcgaggcatggaacaagagcccctactaagaaacgaatgaaggaaatg
gaaaggctagccatttcactacaagcactcatagaagatgcaaaagaacgcaaactgtct
ttagataatgttcctgcttggttatttgactggacgtctccatggaaaggaaaggtgaaa
ggaggagaattgattgtcaaaggagaagatgaactctatgatcttggaatcaggattcga
gaaaaatttccagatctgctaaatgatgaataccaccccgatgtgtataccatcaaagca
actcaggttcctcgggcgtctgctagtgctgtggcatttgcgatggggctgtttagcgga
agaggaagccttgggcctgggaaacatcgtgcttttgctgttagtactgagagtcgtgca
agtgacttattgctgaggttttttgatacctgccaaagttacaagaactacaggaaaagt
gaggaacctgcagttgaaaaacttaaggaacctatttttgacgaaatcacccatgctttg
tctggacgttcaggattgaatttcaccagacaagatatatcttctctctggttcttatgc
aagcaggaagcgtcattactagacataaccaatcaggcttgtgggctttttaacccgact
gagctggctctgctggaatggacagatgatctggaggtgtttgtgttgaaagggtatgga
aaatctgtgaactacaagatgggattgcctttgctgaaagatgtagttgagtctatggag
cttgctgtcaagtctaatgaagaagcactgcctagtgggagttatgagaaagcacggctt
cgattcgctcatgcagaaactgtggttccattctcatgtctgcttggtctctttcttcaa
ggctctgaatataatcttatactgaaggaaaaaccattggaactccctccaaagcctccc
aagaggcgagcttggaggggaagtgctgtggctccatttgctgggaacaatatgcttgta
ctttatagctgtccagccagaaaatcaagcaagtattttgttcaagtactgcataatgag
catccagtacctttacctggctgtgacaactctgacttttgtccattcgaagtttttaag
gaaaggatacttgagcctcatatgaaacacgattatcatgctatatgcagagtgaaggaa
gaagcagcaccagtggctgcatccagtaagttatcatcgttgtttttttggctgttttct
tggcatagtgaaggaaaggagtctgacaatgttgatctgtaa

DBGET integrated database retrieval system