KEGG   Beta vulgaris (sugar beet): 104906090
Entry
104906090         CDS       T03548                                 

Gene name
BV-70/5
Definition
(RefSeq) V-type proton ATPase catalytic subunit A
  KO
K02145  V-type H+-transporting ATPase subunit A [EC:7.1.2.2]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00190  Oxidative phosphorylation
bvg01100  Metabolic pathways
bvg04145  Phagosome
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    104906090 (BV-70/5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    104906090 (BV-70/5)
Enzymes [BR:bvg01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     104906090 (BV-70/5)
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_Xtn ATP-synt_ab_N AAA_18
Other DBs
NCBI-GeneID: 104906090
NCBI-ProteinID: NP_001290002
UniProt: Q39442
Position
2
AA seq 623 aa
MPAVYGDRMTTFEDSEKESEYGYIRKVSGPVVVADGMNGAAMYELVRVGHDNLIGEIIRL
EGDSATIQVYEETGGLTVNDPVLRTHKPLSVELGPGILGNIFDGIQRPLKTIAKRSGDVY
IPRGVSVPPLDKDTQWDFQPKKLGVGDLLTGGDLYAIVDENSLMQHHVVLPPDAMGKITY
IAPAGNYTIQDTVLELEFQGVVKKFTMLQTWPVRTPRPVASKLAADTPLLTGQRVLDALF
PSVLGGTCAILGAFGCGKTVISQALSKYSNSDAVVYVGCGERGNEMAEVLMDFPQLTMTL
PDGREESVMKRTTLVANTSNMPVAAREASIYTGITIAEYFRDMGYNVSMMADSGSRWAEA
LREISGRLAEMPADSGYPAYLAARLASFYEAAGKVKCLGGPERNGSVTIVGAVSPPGGDF
SDPVTSATLSIVQVFWGLDKKLAQRKHFPSVNWLISYSKYSGALESFYEKFDSEFIDIRT
KAREVLQREDDLNEIVQLVGKDALAETDKITLDTAKLLREDYLAQNAFTAYDKFCPFYKS
VWMMRNIIHFYNLANQAVERGAGSDGQKITYSLIKLRLGDLFYRLVSQKFEDPAEGEDAL
VAKFKKLNEDLTAAFRNLEDETR
NT seq 1872 nt   +upstreamnt  +downstreamnt
atgccggccgtttatggagatcgtatgaccacatttgaggactctgagaaagagagcgag
tatggatacattcgtaaggtgtcaggacctgtggtcgttgctgatggaatgaatggtgct
gctatgtatgaattggtacgtgttggacatgacaatcttattggagaaattattcggtta
gaaggagattctgccaccatccaagtttatgaagaaactggtggtttgacggtcaatgat
cctgttcttcggactcacaagccattgtcagttgagcttggacctggaattttgggaaat
atatttgatggtatccagagaccgttgaaaactattgctaaaaggtcgggtgatgtttac
atacctcgtggtgtttctgtgcctcccttggataaagacacgcagtgggacttccagcct
aagaaactaggcgtaggggatctgttgactggtggagacttatatgctatcgtagatgag
aacagtttgatgcaacatcatgtcgtcctgccacctgatgccatgggcaagattacgtac
atcgcacctgcagggaactacactattcaggacactgttctggaacttgagtttcaaggt
gtggtgaagaagtttaccatgcttcagacttggcccgtccgtacaccaagacctgttgca
tctaaacttgcagctgacacccctctactgactgggcagcgtgttcttgatgctcttttt
ccctcagttcttggtggaacttgtgccattcttggggcttttggctgtggaaaaactgtc
attagtcaagcactttctaagtactctaactctgatgctgtggtttatgttggttgtgga
gaaagaggaaatgagatggctgaggtgctcatggattttcctcaactaaccatgacattg
cctgatggacgtgaagaatccgttatgaaacgtactacacttgttgcaaatacttctaac
atgcctgtggctgcacgtgaggcgtccatttacacaggtatcacaatagctgaatatttc
agagatatggggtacaatgtcagtatgatggcagactcagggtctcggtgggcagaagct
ttgcgtgaaatttcaggacgattggcggagatgcctgctgacagtggatatcctgcttat
ttggctgctcgtttagcttctttctatgaagctgccggtaaagttaaatgtcttggtggt
ccagagcgtaatggtagtgtaacaattgttggtgctgtttctcctcctggaggagatttc
tctgatcctgttacatctgcaacactgagtattgtgcaggttttctggggtttggataag
aaactggctcagaggaaacattttccctccgtcaactggcttatttcttactcaaagtat
tcaggggctttggaatcattttatgagaaattcgactccgagttcattgatatcaggacc
aaggcccgtgaggtgctacaaagagaagatgatctcaatgaaattgtccagcttgttgga
aaagatgctttggctgagacggataaaatcactttggacactgcaaagcttttgagggaa
gactatctggcacaaaatgcatttacagcatatgacaaattttgcccattctacaagtca
gtctggatgatgcgcaacattatccatttctacaatttggccaatcaggctgtggagcgt
ggtgctggttcagatggtcagaagattacctacagcttgatcaagcttcggctaggagat
cttttctaccgtttagtgtcacagaaattcgaggatccggctgagggagaggatgctctt
gttgccaaattcaagaagttgaatgaggatctgactgctgctttccgcaatctcgaggat
gaaacccgatga

DBGET integrated database retrieval system