KEGG   Beta vulgaris (sugar beet): 104907666Help
Entry
104907666         CDS       T03548                                 

Definition
(RefSeq) methionine--tRNA ligase, cytoplasmic
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
bvg  Beta vulgaris (sugar beet)
Pathway
bvg00450  Selenocompound metabolism
bvg00970  Aminoacyl-tRNA biosynthesis
bvg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    104907666
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    104907666
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:bvg01007]
    104907666
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bvg03016]
    104907666
Enzymes [BR:bvg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     104907666
Amino acid related enzymes [BR:bvg01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   104907666
Transfer RNA biogenesis [BR:bvg03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    104907666
 Prokaryotic type
   Other AARSs
    104907666
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 Laminin_EGF
Motif
Other DBs
NCBI-GeneID: 104907666
NCBI-ProteinID: XP_010694958
Position
1
AA seq 597 aa AA seqDB search
MSQSEEKVPISGKRNILVTSALPYVNNVPHLGNIIGCVLSADIFARFCRLRGDNVLFVCG
TDEYGTTTEVRAAKDNLTPREICDKYHPLHKETYDWFDIKFDQFGRTSTPEHTVICHEVL
DSLNNKKLLEENVLEQLYCEQCLKFLADSLVEGQCPRCLLPCKGDQCESCGAFVNARDLL
SPTCKICGSLSLTLRKSEHLFLKLADLQQDLRALSDRITFSNQQAVTHTNNLLHNELQPK
CITRDLKWGVPVPKFKEKVLYVWFDAPLGYISITKCHTSKWELWWKNPENVELHCFMGKD
NVPFHSVYFPSYLIGTGEKWTLPHSIHATHFLLYGAGKFSKSNGIGVFGDDAKKTDIPVE
VWRYYLTSVRPETSDSRFFWKDLQAKLNSELADNLGNFINRVLTFVAKPPEKGYNSVIPD
VSDVVLTEMDTELCDYLKHYVQEYVKTLEKGKLKDGLKAAMAIANEGNRYFQRSQVWKLY
ISDRSRCSFVVKTLVGVVCILACLLQPFMPSFSTEVLKQLQLEAHEFTLQNDDIERVQKP
WEIVPAGHKIGKPCQLFKKLNEDDVDKLEKKFCGRQDDRSENVKVLNKSKSEVCIAK
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagtcggaggagaaggtaccaatctcaggcaagaggaacatattagtaacgagt
gccctcccatatgtcaataatgtgcctcatctaggcaatatcattggatgtgtgctgagc
gcggatatatttgctcgattttgtcgtcttagaggtgataatgtgttgtttgtttgtggg
actgacgagtatggtaccactactgaggtccgtgcagctaaggacaatctcactccccgt
gaaatttgtgacaagtaccatcctttgcacaaggagacctatgactggtttgatattaag
tttgatcaatttggccgaacttctactcctgaacacactgtcatttgtcatgaagtcctc
gattcacttaacaacaagaagctcttggaggaaaatgttcttgaacagttgtattgtgag
caatgcttaaagttcttagcagatagtcttgttgaaggtcagtgtcctcgctgccttttg
ccttgtaaaggtgatcaatgcgagagctgtggcgcgtttgtgaatgctcgagatttgctt
agccctacctgcaagatttgtgggagtttgagcctgactctccgcaaatcagagcatctg
tttctgaaactagctgatctgcagcaggacttgcgcgccctttctgataggattacattc
tcaaatcaacaagcagtgacccatacaaataatcttcttcataacgaacttcagccaaag
tgcatcactcgtgaccttaaatggggagtacctgttccaaaatttaaagaaaaggtgctg
tatgtttggtttgatgccccccttggttatatatccatcacaaagtgtcacacatccaag
tgggagctatggtggaaaaatcctgagaatgtcgagcttcattgtttcatggggaaagac
aatgtcccttttcactcggtctattttccgtcatatctgattggaacaggggaaaaatgg
acccttcctcattcgatacatgctactcattttctgttatatggagcaggaaaattttct
aagagcaatggtattggtgtgtttggtgatgatgcgaaaaaaacagatatacctgtagaa
gtatggagatactatttgacaagtgttagaccggagacatctgactcaagatttttttgg
aaggacttgcaagctaaactgaacagcgaacttgctgataatttgggcaacttcatcaac
cgtgtgctcacctttgttgctaagccccccgaaaaaggatataactctgttatccctgat
gtctctgatgttgtgctgactgagatggacactgaattatgtgattaccttaaacactat
gtgcaggaatatgtcaagactttggagaagggtaagttgaaggatggtttaaaggctgca
atggctattgctaacgagggaaatcgatacttccagagaagtcaagtttggaagctttac
attagtgatagatcgaggtgctcttttgttgtcaaaactttagttggagttgtttgcatt
cttgcatgcctgcttcaaccatttatgccatcatttagcacagaggtgttgaagcaactt
cagcttgaagctcatgagttcacacttcaaaacgacgacattgagagggttcaaaagcct
tgggaaattgtccctgctggtcataaaatagggaagccatgtcaattgttcaagaaattg
aacgaggacgatgttgacaaactggagaaaaagttctgtggaagacaggatgatcggtct
gagaatgtcaaggtactcaacaaaagcaagtctgaggtctgcattgccaaataa

DBGET integrated database retrieval system