KEGG   Beta vulgaris (sugar beet): 109133519Help
Entry
109133519         CDS       T03548                                 

Definition
(RefSeq) wall-associated receptor kinase-like 22
  KO
K04733  interleukin-1 receptor-associated kinase 4 [EC:2.7.11.1]
Organism
bvg  Beta vulgaris (sugar beet)
Brite
KEGG Orthology (KO) [BR:bvg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bvg01001]
    109133519
Enzymes [BR:bvg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     109133519
Protein kinases [BR:bvg01001]
 Serine/threonine kinases: TKL group
  IRAK family
   109133519
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase
Motif
Other DBs
NCBI-GeneID: 109133519
NCBI-ProteinID: XP_019104247
Position
4
AA seq 342 aa AA seqDB search
MGQTQTKYIKKIKNKRRAKFDCKEEYFIKNGGILLEKQIALSQGQHKGAGQLKIFSSQDI
AKATNNYDPDLIVGTSAYGTVYKTTIDDRMVVVKALLEREPNPEQIDLFLTEASTVMVMN
HDNMVKFYGCCLETCIPILVYEYLSNADLFERLHGDVIKWADRLRVATDIAYALSYMHNA
LSKPVVHRHVNSMGIILDYSFNGKLADFLYSVSITPGETPATRWPVEGTPGYIDPEYIET
QEVTEKCDVYSFGVLMLELLTRKQPLMMARGGIDLVDVFVSAVQKNCMMEMVDTVVLEQA
TMNEIRQFVQLALMCVAKKGTERPTMVDVVGELWKIQGRDKK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaaactcaaacaaagtacattaagaagataaagaataagagaagggcaaaattc
gactgcaaggaggaatattttattaagaatggaggtattttgctagagaaacaaattgct
ctgagccaaggacagcataaaggagcagggcagttgaaaattttctcgagccaggatatt
gcaaaggctacgaacaactatgaccctgatctcattgttggaactagtgcttacggtact
gtctataagacaaccattgatgatcgtatggtagtcgtcaaagccttgttagagcgagag
ccaaatcctgaacagattgatctctttttaactgaagcctcaacggtgatggttatgaat
catgacaatatggtaaaattctatggctgttgccttgagacatgtataccaatactagtg
tatgagtacttatcaaatgccgacctttttgagaggttacatggtgatgttataaagtgg
gctgatcgtttgagagttgcaactgatatagcctatgcgctatcttatatgcataatgcc
ttatcaaagccagtggtgcacaggcatgttaactcaatgggtataatccttgattattca
ttcaatggaaaattagcagactttttgtattcagtgtccataactccgggggagactcct
gcaactagatggcctgttgaaggaactccaggatatattgatcccgaatacatagaaaca
caagaggtgacagaaaagtgtgatgtgtatagttttggggttttgatgttggaactatta
actagaaagcagccccttatgatggccagaggtgggatagacttggttgacgtgtttgtt
tcagccgtgcagaaaaattgcatgatggagatggttgacacggtggtcttagagcaagcc
accatgaacgagattagacagtttgtacaacttgcattgatgtgtgtggcaaaaaaagga
actgagagaccgactatggttgatgtagttggtgagctttggaagatacaaggtcgagac
aagaagtga

DBGET integrated database retrieval system