KEGG   Burkholderia vietnamiensis G4: Bcep1808_0443
Entry
Bcep1808_0443     CDS       T00493                                 

Definition
(GenBank) hypothetical protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: ABO53455
UniProt: A4JB02
Position
1:475607..475831
AA seq 74 aa
MDHLLSRYEYGLGLFVRALGDFAIRYPKTAAWLGIQSGRTDDPQVTRQIQTFSSLAARFV
RSGSKTTPNSPRRC
NT seq 225 nt   +upstreamnt  +downstreamnt
atggatcacctgttgtcgcgttacgaatacggactcgggttgttcgtgcgtgcactgggc
gatttcgctatccgatacccaaagaccgccgcctggctcggcatccagagcgggcggact
gacgatccgcaagtgacgcgtcagattcagaccttttcgtctcttgcagcgcgcttcgtc
cgaagcgggtcgaagactaccccgaattcaccaaggcgctgctag

DBGET integrated database retrieval system