KEGG   Burkholderia vietnamiensis G4: Bcep1808_0456Help
Entry
Bcep1808_0456     CDS       T00493                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11892  type VI secretion system protein ImpK
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep1808_0456
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_0456
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DotU
Motif
Other DBs
NCBI-ProteinID: ABO53468
UniProt: A4JB15
Position
1:complement(491636..492418)
Genome map
AA seq 260 aa AA seqDB search
MSYAPSLFGDNAPAPLHTPASTDAAFQARSLLDLLYDGFFMLFLLKNGRAPDSASEFSTK
IQEFLSDFERGAKKLNIAAEDVYAAKFAYCAAVDEMVLSSQFKIRADWERRPLQLVLFGE
QLAGEKFFQYLEECRAQGAARLQSLEVFHMCLLLGFQGKYLLEGPEKLAYLTARLGDEIA
HMKGKRAAFAPHWPLPDQIAHRLKREVPVWAIGAVFALVALLGYLGLNTYLKDKTLQALA
PYSQVIKVGPESANLTISLP
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagctacgcgccttccctgttcggcgacaacgcgccggccccgttgcataccccggcg
tcgaccgacgccgcgttccaggcccgctcgctgctcgacctgctgtacgacgggttcttc
atgctgttcctgctcaagaacggccgcgcgccggacagcgcgagcgagttcagcacgaag
attcaggaattcctgtcggacttcgaacgcggcgcgaagaagctgaatatcgcggcggag
gacgtgtatgcggcgaagttcgcgtattgcgcggccgtcgacgagatggtgctgtcgtcg
cagttcaagatccgggccgactgggaacgccggccgctgcagctggtgctgttcggcgag
cagctcgcgggcgagaagttcttccagtatctggaggaatgccgggcgcaaggtgcggcg
cggctgcagtcgctcgaggtgttccacatgtgcctgctgctcgggttccagggcaagtat
ctgctcgaggggccggagaagctcgcttatctcaccgcgcggctcggcgacgagatcgcg
catatgaagggcaagcgcgctgcgtttgcgccgcattggccgctgccggatcagattgcg
caccggttgaagcgcgaggtaccggtgtgggcgatcggcgcggtgttcgcgcttgtggcg
ctgctcggctatctcgggctgaacacctatctgaaggacaagacgctgcaggcgctggcg
ccttattcgcaggtgatcaaggtcgggccggagtcggcgaatctgacgatttcgctgcct
tga

DBGET integrated database retrieval system