KEGG   Burkholderia vietnamiensis G4: Bcep1808_0458
Entry
Bcep1808_0458     CDS       T00493                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K11906  type VI secretion system protein VasD
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep1808_0458
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_0458
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_0458
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ABO53470
UniProt: A4JB17
Position
1:complement(493864..494475)
AA seq 203 aa
MKSTMIRYALPLLASALLAGCAAAPLLGSAASAVMQAAGIGKPELPDSQKPPRNIGLTLA
AASNLNAANDRKPLALVVRLYSLKDPTSFQQAPFDAFTDPTKEKAALGADLLNVREITLI
PGQRYTATEKVSREAQAFGIVALFRDPAIQRWKLTFDPAKSEKSGIIIGLHNCAMTVTDG
TVIAPQQGAPSQPLNLLSSVTCG
NT seq 612 nt   +upstreamnt  +downstreamnt
atgaaatcgaccatgattcgctatgcgctgccgctgctcgcgagcgcgctgctggccgga
tgtgcggccgccccgttgctcggctcggccgcgagcgccgtgatgcaggccgccggcatc
ggcaagcccgagctcccggattcgcagaagccgccgcgcaacatcgggcttacgctcgcg
gcggcgtcgaacctgaacgccgcgaacgatcgcaagccgctcgcattggtggtgagactc
tactcgctgaaggacccgacttcgttccagcaggcgccgttcgacgcgttcaccgatccg
accaaggaaaaggccgcgctcggcgccgatctgctgaacgtgcgcgagatcacgctgatt
ccgggccagcgctatacggcgaccgaaaaggtgtcgcgcgaagcgcaggcattcggcatc
gtcgcactgttccgcgatccggccatccagcgctggaaactgacgttcgacccggcaaag
tcggagaaatccggcataatcatcggcctgcataattgcgcgatgacggtcaccgatggc
accgtgatcgcaccgcaacagggtgcgccttcgcaaccgctgaatttgctttcgtcggtc
acctgcggataa

DBGET integrated database retrieval system