KEGG   Burkholderia vietnamiensis G4: Bcep1808_0462Help
Entry
Bcep1808_0462     CDS       T00493                                 

Definition
(GenBank) protein of unknown function DUF796
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep1808_0462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_0462
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_0462
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ABO53474
UniProt: A4JB21
Position
1:497632..498135
Genome map
AA seq 167 aa AA seqDB search
MLHMHMQFGSPAVKGESADKDHQGWIELKSWDHSIVQPRSATASTAGGHTMTRCEHGDMI
FTKEIDSSSPLLYQHASGGTTFDEVTVHFSRADGEGKRVQYLEVKLKYVIISSIAPSVRE
EGLPIETFSLKYAAVQWKQTQQKIGGNQGGNTQGAWSLTKNDKTYAV
NT seq 504 nt NT seq  +upstreamnt  +downstreamnt
atgttacatatgcacatgcagtttggtagtccggcggtgaagggcgagtccgccgacaag
gaccatcagggctggatcgaactgaaatcgtgggatcactcgatcgttcagccgcgttcg
gcaacggcatcgaccgcaggcggtcacacgatgacgcgttgcgagcacggcgacatgatc
ttcacgaaggagatcgattcgtcgagcccgctgctgtatcagcacgcttcgggcggcacc
acgttcgacgaagtcacggtccatttctcgcgcgcggacggcgaaggcaagcgcgtgcag
tatctggaagtgaagctcaagtacgtgatcatctcgagcatcgcgccgagcgtgcgtgaa
gaaggtctgccgatcgagacgttctcgctcaagtacgcagccgtgcagtggaagcaaacc
cagcagaagatcggcggcaaccagggcggcaacacgcagggcgcctggagtctgacgaag
aacgacaagacctacgcggtctaa

DBGET integrated database retrieval system