KEGG   Burkholderia vietnamiensis G4: Bcep1808_0514Help
Entry
Bcep1808_0514     CDS       T00493                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bcep1808_0514
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 HHH_2
Motif
Other DBs
NCBI-ProteinID: ABO53526
UniProt: A4JB73
Position
1:556922..557329
Genome map
AA seq 135 aa AA seqDB search
MARAVTYSGNTMSQYQFTVSVKTSYLPEQSDPDRRQYAFAYTLTIRNTGQVAAQLIARHW
IITDSENHVQEVKGLGVVGHQPLLQPGEHFEYTSWAVIATPVGTMRGAYFCVAEDGERFE
APVEEFALHMPRTLH
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atggcgcgggcggttacctacagcggaaacaccatgagtcagtatcagttcaccgtttcg
gtgaaaaccagttacttgccggaacaatccgacccggatcgacgtcaatacgcattcgcg
tacacgctgaccatccgcaatacggggcaggttgcagcgcaactgatcgcccgtcactgg
atcatcacggacagcgaaaatcacgtgcaggaagtgaaggggctcggcgtcgtcgggcac
cagccgctgctgcagccgggcgaacatttcgagtacacgagctgggccgtgatcgcgacg
ccggtcggcacgatgcgcggtgcgtatttctgtgtggcggaagacggtgagcggttcgag
gcgcccgtcgaagaatttgcgctgcacatgccgcgcacgctgcattga

DBGET integrated database retrieval system