KEGG   Burkholderia vietnamiensis G4: Bcep1808_0991Help
Entry
Bcep1808_0991     CDS       T00493                                 

Definition
(GenBank) tRNA (Guanine37-N(1)-) methyltransferase
  KO
K00554  tRNA (guanine37-N1)-methyltransferase [EC:2.1.1.228]
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:bvi03016]
    Bcep1808_0991
Enzymes [BR:bvi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.228  tRNA (guanine37-N1)-methyltransferase
     Bcep1808_0991
Transfer RNA biogenesis [BR:bvi03016]
 Prokaryotic type
  tRNA modification factors
   Methyltransferases
    Bcep1808_0991
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA_m1G_MT
Motif
Other DBs
NCBI-ProteinID: ABO54002
UniProt: A4JCJ9
Position
1:1077652..1078446
Genome map
AA seq 264 aa AA seqDB search
MNQATERAVQFDVVTLFPEMFRALTDWGITSRAVKQERFGLRTWNPRDFTTDNYRTIDDR
PYGGGPGMVMLAKPLEAAIGAAKAAQAEQGIASTRVVMMSPQGAPFTHERAVRMAQEPGV
VVLCGRYEAIDQRLLDRCVDEEISLGDFVLSGGELPAMAMMDAVVRLLPGVLNDAQSAVQ
DSFVDGLLDCPHYTRPEEYEGMRVPDVLLGGHHAEIEKWRRQEALRNTLRKRPDLIVRAR
REKLLSRADEAWLANLAREAKNAS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaggctacggagcgcgcggtgcagttcgatgtcgtcacgctctttcccgagatg
ttccgtgcgctgaccgactggggtatcaccagccgggccgtgaagcaggagcgcttcggg
ctgcgcacctggaatccgcgtgatttcacgacggacaactaccgcacgatcgacgatcgt
ccgtacggcggcggtccgggcatggtgatgctcgcaaagccgctcgaggctgcgatcggc
gccgcgaaggcggcgcaggcggagcagggcatcgcgagcacgcgcgtggtgatgatgtcg
ccgcagggcgcgcctttcacgcacgaacgtgcggtgcgcatggcgcaggagccgggcgtc
gtcgtgctgtgcggccgttacgaggcgatcgatcagcgtctgctcgaccgatgtgtggac
gaggagatcagtctcggcgatttcgtgctgtccggcggcgagttgccggcgatggcgatg
atggatgcggtcgtgcgtctgctgcccggcgtgctgaacgatgcgcagtcggccgtgcag
gacagcttcgtcgacggcttgctcgattgtccgcattacacgcgccccgaggaatacgag
gggatgcgcgtgccggacgtgctgctcggcgggcatcatgccgagatcgagaagtggcgg
cgccaggaagcattgagaaacacgttgcggaagcggccggacctgatcgtccgggcgcgc
cgcgagaagttgctgagccgcgccgacgaggcgtggcttgcgaacctcgcacgcgaagcg
aaaaacgcctcctga

DBGET integrated database retrieval system