KEGG   Burkholderia vietnamiensis G4: Bcep1808_1431Help
Entry
Bcep1808_1431     CDS       T00493                                 

Definition
(GenBank) butyryl-CoA:acetate CoA transferase
  KO
K01029  3-oxoacid CoA-transferase subunit B [EC:2.8.3.5]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00072  Synthesis and degradation of ketone bodies
bvi00280  Valine, leucine and isoleucine degradation
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep1808_1431
  09103 Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    Bcep1808_1431
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep1808_1431
Enzymes [BR:bvi01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.5  3-oxoacid CoA-transferase
     Bcep1808_1431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_trans AcetylCoA_hyd_C
Motif
Other DBs
NCBI-ProteinID: ABO54439
UniProt: A4JDT6
Position
1:1538477..1539118
Genome map
AA seq 213 aa AA seqDB search
MAWNRDQMAARAAKELQDGFYVNLGIGLPTLVANHVPAGVEVWLQSENGLLGIGPSPTDE
EVDADLINAGKQTVTTLPGSSIFSSADSFAMIRGGHINLAILGAMQVSKNGDLANWMIPG
KMIKGMGGAMDLVAGVKRVVVLMEHVAKGDQHKILEECNLPLTGVGVVDLIITDLGVIEV
TPNGLKVLELADGVGVDEIQAKTGAPLDVSAVA
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaatcgtgaccagatggccgcgcgcgcggcgaaggaactgcaggacggcttc
tacgtgaacctcggcatcggtctgccgacgctcgtcgcgaaccacgtgccggccggcgtc
gaagtgtggctgcagtcggagaacggcctgctcggcatcggcccgtcgccgaccgacgaa
gaggtcgatgccgatctgatcaacgccggcaagcagaccgtcacgacgctgcccggctcg
tcgatcttctcgtcggccgattcgttcgcgatgattcgcggcggccacatcaacctcgcg
atcctcggcgcgatgcaggtcagcaagaacggcgatctcgcgaactggatgatccccggc
aagatgatcaaggggatgggcggcgcgatggatctcgtcgcgggcgtgaagcgcgtcgtc
gtgctgatggagcacgtcgcgaagggcgaccagcacaagatcctcgaggaatgcaacctg
ccgctgacgggtgtcggcgtggtcgacctgatcatcaccgatctcggcgtgatcgaagtg
acgccgaacggcctgaaggtgctcgagctcgccgacggtgtcggcgtcgacgaaatccag
gccaagacgggcgcgccgctcgacgtgagcgcggtcgcataa

DBGET integrated database retrieval system