KEGG   Burkholderia vietnamiensis G4: Bcep1808_1742Help
Entry
Bcep1808_1742     CDS       T00493                                 

Definition
(GenBank) nucleoside diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00230  Purine metabolism
bvi00240  Pyrimidine metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01130  Biosynthesis of antibiotics
Module
bvi_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
bvi_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
bvi_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Bcep1808_1742
   00240 Pyrimidine metabolism
    Bcep1808_1742
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bvi04131]
    Bcep1808_1742
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Bcep1808_1742
Membrane trafficking [BR:bvi04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Bcep1808_1742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: ABO54746
UniProt: A4JEP3
Position
1:complement(1896836..1897261)
Genome map
AA seq 141 aa AA seqDB search
MAIERTLSIIKPDAVAKNVIGQIYSRFEGAGLKIVASRMAHLSRADAEKFYAVHAARPFF
KDLVDFMISGPVMIQVLEGEGAILKNRDLMGATDPKKAEKGTIRADFADSIDANAVHGSD
AAETAAVEIAFFFPEMNVYSR
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggcaatcgagcgcaccctgtcgatcatcaagccggatgcggtggcaaagaacgtgatc
ggccagatctacagccgtttcgaaggcgccggcctgaagatcgtcgcatcgcgcatggcg
cacctgtcgcgtgccgacgcagagaagttctacgcagttcacgcagcacgtccgttcttc
aaggacctcgtcgacttcatgatctcgggtccggtgatgatccaggttctggaaggcgaa
ggcgcgatcctgaagaaccgcgacctgatgggcgcgacggatccgaagaaggcggaaaag
ggcacgatccgcgccgacttcgccgacagcatcgacgcgaacgccgtgcacggctcggac
gctgctgaaacggcagcggtcgaaatcgcgttcttcttcccggaaatgaacgtctactcg
cgttaa

DBGET integrated database retrieval system