KEGG   Burkholderia vietnamiensis G4: Bcep1808_1928Help
Entry
Bcep1808_1928     CDS       T00493                                 

Definition
(GenBank) metal dependent phosphohydrolase
  KO
K00990  [protein-PII] uridylyltransferase [EC:2.7.7.59]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcep1808_1928
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.59  [protein-PII] uridylyltransferase
     Bcep1808_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GlnD_UR_UTase ACT HD ACT_6 NTP_transf_2 DUF294 ACT_4 HTH_Tnp_ISL3 GlnE
Motif
Other DBs
NCBI-ProteinID: ABO54931
UniProt: A4JF78
Position
1:2099725..2102304
Genome map
AA seq 859 aa AA seqDB search
MSAHAAPSPEALSRRAEFKAAKADLLERFRSATNVTSLMHALSKLTDSALKRVWDDCGLP
ATLALVAVGGYGRGELAPHSDVDILVLLPDAHDPALDARIERFIGMAWDLGLEIGSSVRT
VAQCIEEASQDVTVQTSLLEARRIFGSTALFERFTVRYHEEALDARAFFTAKVLEMRQRH
AKFQDTPYSLEPNVKESPGGLRDLQTILWIARAAGFGSSWRELDTRGLITEREARELRRN
EGFLKALRARLHVIAGRRQDVLVFDLQTQAAESFGYRPTQAKRASEQLMRRYYWAAKAVT
QLATILIQNIEAQLFPATSGITRVLSHDRFVEKQGMLEIVDDGVFERHPDAILEAFLLYE
TTRGVKGLSARTLRALYNSREIMNDTWRRDAQNRHTFMQILQQPEGITHAFRLMNQTSVL
GRYLLNFRRIVGQMQHDLYHVYTVDQHILMVLRNIRRFAVAEHAHEYPFCSQLIGNFERP
WVLYVAALFHDIAKGRGGDHSTLGMADARRFCREHGIGGDDAALIVWLVQHHLTMSQVAQ
KQDTSDPEVIKRFAAIVGNERYLTALYLLTVADIRGTSPKVWNTWKGKLLEDLYRITLAV
LGGAKPDAHSELKSRQEQALALLRLETVPDDAHRALWDQLDVGFFLRHDAADIAWQTRVL
YRHVNAETAIVRARPSPIGDALQVLVYVKDRPDLFAGICAYFDRNGLSVLDARVSTTRHG
YALDNFIVTQTERDVRYRDIANLVEQQLATRLAETAPLPEPSKGRLSRLSRTFPITPRVD
LRADERGQYYILSVSANDRPGLLYSIARVLAEHRVGVHAARINTLGERVEDIFLLDGAGL
SDNRLQIQLETELLRAIAV
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atgagcgctcacgccgccccctcgcccgaagcgctgtcgcggcgcgccgaattcaaggcc
gccaaggccgacctgctcgagcgctttcgcagcgcgaccaacgtcacgtcgctgatgcac
gcgctgtcgaaactcaccgacagcgcactgaaacgcgtatgggacgactgcgggctgccc
gcgacgctcgcgctggtcgccgtcggcggctacgggcgcggcgaactcgcgccccactcc
gacgtcgacatcctcgtcctgctgcccgatgcgcacgatccggcgctcgatgcgcgcatc
gagcgcttcatcgggatggcgtgggatctcggcctcgagatcggcagcagcgtacggacg
gtcgcgcaatgtatcgaagaggcgtcgcaggacgtcaccgtgcagacctcgctgctcgag
gcgcgccgcatcttcggcagcaccgcgttgttcgagcgcttcaccgttcgctatcacgaa
gaggcgctcgatgcgcgcgccttcttcaccgcgaaggtgctcgagatgcgtcagcgccac
gcgaagttccaggacacgccgtacagcctcgaaccgaacgtgaaggaaagccccggcggg
ctgcgcgacctgcagaccatcctttggatcgcgcgcgcggccggcttcggcagcagctgg
cgcgagctcgacacgcgcggcctcatcaccgagcgcgaggcgcgcgagctgcgccgcaac
gaagggttcctgaaggcgctgcgcgcgcggctgcacgtgatcgccggccgccgtcaggac
gtgctcgtgttcgacctgcagacgcaggccgccgagagcttcggctatcggccgacgcag
gccaagcgcgcgagcgagcagctgatgcgccgctactactgggcggcgaaggccgtcacg
cagctcgcgacgatcctgatccagaacatcgaggcgcagctgttccccgcgacgagcggc
atcacgcgcgtgctgtcgcacgatcgcttcgtcgagaagcagggcatgctcgagatcgtc
gacgacggcgtgttcgagcgccatcccgacgcgatcctcgaagcgttcctgctgtacgag
acgacgcgcggcgtgaagggcctgtcggcccgcacgctgcgcgcgctgtacaactcgcgc
gaaatcatgaacgacacgtggcggcgcgatgcacagaaccgccacacgttcatgcagatc
ctgcagcagcccgaaggcatcacacatgcgttccggctgatgaaccagaccagcgtgctc
ggccgctatctgctgaattttcgccgcatcgtcggccagatgcagcacgacctgtatcac
gtgtacacggtcgaccagcacatcctcatggtgttgcgcaacatccgccgcttcgcggtg
gccgagcatgcgcacgaatatccgttctgcagccagctgatcggcaatttcgagcgcccg
tgggtgctctacgtcgcggcgctgttccacgacatcgcgaagggccgcggcggcgatcac
tcgacgctcggcatggccgacgcgcgacgcttctgccgcgaacacggcatcggcggcgac
gatgcggcgctgatcgtgtggctggtccagcatcacctgacgatgagccaggtcgcgcag
aagcaggacacgagcgacccggaggtgatcaagcgcttcgccgcgatcgtcggcaacgaa
cgctacctgaccgcgctctatctgctgaccgttgccgatatccgcggcaccagcccgaag
gtgtggaacacctggaagggcaagctgctcgaggatctgtaccgcatcacgctcgcggtg
ctcggcggcgcgaagcccgatgcgcattcggaactgaagtcgcgccaggagcaggcgctc
gcgctgctgcgcctcgagaccgtgcccgacgacgcgcatcgcgcgctgtgggatcagctc
gacgtcggcttcttcctgcgtcacgacgcagccgacatcgcgtggcagacgcgcgtgctg
taccgccacgtgaacgccgagaccgcgatcgtgcgggcgcggccgtcgccgatcggcgac
gcgctgcaggtgctcgtgtacgtgaaggaccgccccgacctgttcgcgggcatctgcgcg
tatttcgaccgcaacgggctgtcggtgctcgatgcccgcgtcagcacgacgcggcacggc
tacgcgctcgacaacttcatcgtcacgcagaccgagcgcgacgtgcgctaccgcgacatc
gcgaatctcgtcgaacagcagctcgcgacgcggctcgccgaaaccgcgccgctgccggag
ccgtcgaagggccgcctgtcgcgactgtcccgcacttttccgatcacgccgcgcgtcgac
ctgcgggccgacgagcgcggccagtactacatcctgtccgtgtccgcgaacgaccggccg
ggccttctctattcgatcgcgcgcgtgctggccgagcatcgggtcggcgtccatgcggcg
cggatcaatacgctcggcgaacgcgtcgaggacatcttcctgctcgatggtgccggcctg
tccgacaaccgcctgcagatccagcttgaaaccgaattgctgcgcgcgatcgcagtctga

DBGET integrated database retrieval system