KEGG   Burkholderia vietnamiensis G4: Bcep1808_2760Help
Entry
Bcep1808_2760     CDS       T00493                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00020  Citrate cycle (TCA cycle)
bvi00640  Propanoate metabolism
bvi00660  C5-Branched dibasic acid metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
Module
bvi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bvi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bcep1808_2760
   00640 Propanoate metabolism
    Bcep1808_2760
   00660 C5-Branched dibasic acid metabolism
    Bcep1808_2760
Enzymes [BR:bvi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bcep1808_2760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp K-cyclin_vir_C SAA
Motif
Other DBs
NCBI-ProteinID: ABO55751
UniProt: A4JHJ8
Position
1:complement(3054017..3055183)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKTIEQVREYANQILGMQLVTHQTGPEGQKVNRLLIEEGADIKQELYVSLVVDRVSQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARTI
LQGLYKAFWETDASLAEINPLNVSGDGKVTALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcagaagagctgggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggtcgcggcaagggcggcggcgtg
aaagtcgcgaagacgatcgagcaggttcgtgaatacgcgaaccagatcctcggcatgcag
ctcgttacgcaccaaacgggtccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgccgacatcaagcaggagctgtacgtcagcctcgtcgtcgatcgcgtgtcgcaaaag
atcgttctgatgggttcgagcgaaggcggcatggacatcgaagaagttgcggaaaagcat
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgacgcgcaggcg
gacgacctcgccgcgaagatcggcgtgccggctgcatcgatcccgcaagcgcgcacgatc
ctgcaaggcctgtacaaggcattctgggaaaccgacgcgtcgctcgccgaaatcaacccg
ctgaacgtttccggcgacggcaaggtcaccgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgatctcgacgaagaagatccg
gctgaaatcgaagcatcgaagttcgatctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcaggcctcgcgatggcgacgatggacacgatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggcggcgcgacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcgggaagaagatg
ctggccgattcgggcctgccgatcatctcggcagacagcatggaagaggctgcgcagaag
gtcgtcgcggctgcggcaggcaagtaa

DBGET integrated database retrieval system