KEGG   Burkholderia vietnamiensis G4: Bcep1808_2801Help
Entry
Bcep1808_2801     CDS       T00493                                 

Definition
(GenBank) Tetratricopeptide TPR_2 repeat protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPR_17 TPR_16 TPR_2 TPR_14 TPR_11 TPR_12 TPR_19 TPR_1 TPR_10 TPR_9 Wzy_C_2 DUF3437
Motif
Other DBs
NCBI-ProteinID: ABO55792
UniProt: A4JHN9
Position
1:complement(3102091..3103719)
Genome map
AA seq 542 aa AA seqDB search
MQDSNELLIPLLPPLLALLGHAADARARGDADVHALWLAAAGQLHAADSAALAQLTTTLV
ARQRIADALALAECAARVHPGVAALFNHGYALQMAGRHADAVAPYRAAYALDPRWPSLRN
NLAIALRLSGGDRDEEIALLDAAVEADPYDVQAWINLVVARLAALDLDGALASAARLAEI
APDNALALNNIAMAMKEAQRWDDAERYATRACELAPDDASFRFNLAIIQLVRGNYAAGWR
GHEARWDGAGELRGRRPALPGPRWQGEPLAGKTLLVWGEQGLGDVLQFARFVAPLAERAH
REGGRLVWNTFPQLGALMQRSLGAHVDAFSAGGGVDTLPPFDYEVPLIGLPLMLGMETST
LGASVPYLHAEPHARDAWRARLAGERRLKVGLVWTGSAGHQRNPFRRVGLARYADAFGGI
DGVAFYSLQPGADADVAAARAAGFAIEDFTAELKSFDDTAAFIGALDLVITVCTSVAHLS
GALGARTWVALDVNPHWPWLLDRTDSPWYPSATLYRQPTFGAWAPVMDALARDLRGLAAG
RG
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgcaagactcgaacgaactcctgattccgctgctgccgccgctgctcgcgctgctcggc
cacgccgccgacgcgcgtgcgcgcggcgatgccgatgtgcacgcactgtggctggccgcg
gccggccagctgcacgccgccgatagcgcggcgctcgcgcagctgaccacgacgctcgtc
gcgcggcagcgcatcgccgacgcgctcgcgctggcagaatgcgcggcgcgcgtgcatccc
ggtgtcgcggcgctgttcaaccacggctacgcgctgcagatggccggccgtcacgcggac
gcggtcgcgccgtaccgcgcggcctatgcgctcgatccgcgctggccgtcgctgcgcaac
aacctcgcgatcgcgctgcggctgtcgggcggcgatcgcgacgaggaaatcgcgctgctc
gacgcggccgtcgaggccgatccgtacgacgtgcaggcgtggatcaacctggtcgtcgcg
cggctcgcggcgctcgacctcgacggcgcgctcgcatccgcggcgcggctcgcggagatc
gcgcccgacaacgcgctcgcgctgaacaacatcgcgatggcgatgaaggaggcgcagcgc
tgggacgacgccgagcgctacgcgacgcgtgcgtgcgaactcgcgcccgacgacgcatcg
ttccgtttcaacctcgcgatcatccagctcgtgcgcggcaattacgcggccggctggcgc
ggccacgaggcgcgctgggacggcgccggcgagctgcgcggccgccgcccggcgctgccg
ggcccgcgttggcagggcgagccgctcgccggcaagaccttgctcgtctggggcgagcag
gggctcggcgacgtgctgcagttcgcgcgcttcgtcgcgccgctcgccgagcgcgcgcac
cgcgaaggcggccggctcgtgtggaacacgtttccgcagctgggcgcgctgatgcagcgc
agcctcggcgcgcacgtggacgcgttcagcgccggcggcggtgtcgacacgctgccgccg
ttcgattacgaggtgccgctgatcggcctgccgttgatgctcgggatggagacgtcgacg
ctcggcgcgtcggtgccgtacctgcatgcggagccacatgcgcgcgacgcgtggcgcgcg
cggctcgcgggcgagcggcggctgaaggtcgggctcgtgtggacgggcagcgcggggcac
cagcgcaacccgttccggcgcgtcgggctcgcgcgctatgccgatgcgttcggcggcatc
gacggcgtcgcgttttattcgctgcagccgggcgcggatgccgatgtcgccgcggcgcgc
gcggccggtttcgcgatcgaggactttaccgccgagctgaagagtttcgacgacacggcg
gcgttcatcggcgcgctcgatctggtgatcacggtgtgcacgtcggttgcgcatctgtcg
ggcgcgctcggcgcgcgcacctgggtcgcgctcgacgtgaatccgcattggccgtggctg
ctcgatcgcaccgacagcccgtggtatccgagcgcgacgctctaccggcagccgacgttc
ggcgcctgggcgccggtgatggacgcgctcgcgcgcgatttgcgtgggctcgcggctggg
cggggttga

DBGET integrated database retrieval system