KEGG   Burkholderia vietnamiensis G4: Bcep1808_2906Help
Entry
Bcep1808_2906     CDS       T00493                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00900  Terpenoid backbone biosynthesis
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcep1808_2906
Enzymes [BR:bvi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bcep1808_2906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C Astro_capsid_N
Motif
Other DBs
NCBI-ProteinID: ABO55897
UniProt: A4JHZ4
Position
1:3219436..3220317
Genome map
AA seq 293 aa AA seqDB search
MTDSTRSLRNCLAPAKLNLFLHITGRRPNGYHDLQSVFQLLNWGDTLHFTLRDDGRVARA
TDVPGVPEESDLVVRAANLLKAHTGTVAGVDIEIDKCLPMGAGLGGGSSDAATTLLALNR
LWQLDLSRAELQSLAVKLGADVPFFVFGKNAFAEGIGEELAEVQLPTRWFLVVTPRVHVP
TAEIFSDELLTRDTKPVTIADFLARRNSDAGWPDSFGRNDMQQVVTSKYAEVAQVVKWLY
NVTPSRMTGSGASVFAVFRSRHEAEAVKANLPTGWNGAVAESLNEHPLFAFAS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaccgattcgacccgctcgctgcgcaactgccttgcgcccgcgaaactcaacctgttc
ctgcacatcaccggccgccggccgaatggctatcacgatctgcagagcgtgttccagttg
ctgaactggggcgacacgctgcacttcacgctgcgcgacgacggccgcgtcgcacgcgcg
accgacgtgccgggcgtgccagaggaaagcgatctcgtcgtgcgcgcggcgaacctgctg
aaagcacacaccggcaccgtcgcgggcgtcgacatcgagatcgacaagtgcctgccgatg
ggcgcgggccttggcggcggcagctcggatgcggcgacgacgctgctcgcgctgaaccgt
ctgtggcaactcgacctttcgcgtgcggagctgcagtcgctcgcggtgaaactcggcgcg
gacgtgccgttcttcgttttcggaaaaaatgcgttcgcagagggtatcggagaagaatta
gctgaggtacaattgccgactcgctggttcctggttgtgacgccgcgagttcatgtcccc
accgctgagattttttcagatgagctgttgacaagggacacaaagccagtcacaattgct
gactttcttgcacggcgtaacagcgatgcgggatggccagacagtttcggccggaacgat
atgcagcaagttgtgacaagtaagtacgcggaagttgcacaggtggtcaaatggttgtat
aatgtgaccccttcaaggatgaccggctccggagcaagcgtgtttgcggtgtttcgaagc
aggcacgaggcagaagcggtgaaagccaatctgcccaccggttggaatggtgcagttgcc
gagagcctgaacgagcatccgctcttcgctttcgcgtcatga

DBGET integrated database retrieval system