KEGG   Burkholderia vietnamiensis G4: Bcep1808_3320Help
Entry
Bcep1808_3320     CDS       T00493                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00220  Arginine biosynthesis
bvi00250  Alanine, aspartate and glutamate metabolism
bvi00471  D-Glutamine and D-glutamate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bcep1808_3320
   00220 Arginine biosynthesis
    Bcep1808_3320
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Bcep1808_3320
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Bcep1808_3320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: ABO56309
UniProt: A4JJ56
Position
2:8810..9724
Genome map
AA seq 304 aa AA seqDB search
MNYQPILERIHTELAPWIGQGRVADYIPELAKVPADKFGMAVVTLDGNVYTVGDARERFS
IQSISKLFACTLAFQLLGDALWERVGREPSGTAFNSLVQLESERGKPRNPFINAGALVVT
DVLCRRFVKAETALVEFVRRLIGATDVDYDSRVALSELQHAERNRAMAHFMASFGNMQMP
PDTVIDAYCRQCAIEMNCIELAQAALFLANGGVAPVTGERIVDASSAKRLSALMLTCGTY
DAAGDFVYRVGLPAKSGVGGGIVAVLPGEMAVCVWAPGLDANGNSLAGTLALEWLTTYSG
RSIF
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaactaccagccgattctcgaacgcatccacaccgaactcgccccctggatcggccag
ggccgcgtggccgactacattcccgagctggcgaaagtgccggccgacaagttcgggatg
gccgtcgtgacgctcgacggcaacgtttacacggtcggcgacgcgcgggagcgcttctcg
atccagagcatctcgaagctgttcgcgtgcacgctggcgttccagctgctcggcgacgcg
ctgtgggagcgggtgggccgcgagccgtcgggcaccgcgttcaactcgctggtgcagctc
gaaagcgagcgcggcaagccgcgcaatccgttcatcaacgccggcgcgctggtcgtcacc
gacgtgctgtgccgccgtttcgtgaaggccgagacggcgctcgtcgaattcgtgcggcgg
ctgatcggcgcgaccgacgtggattacgattcgcgcgtcgcgctttccgagcttcagcac
gcggagcgcaaccgtgcgatggcgcatttcatggcgagcttcggcaacatgcagatgccg
ccggacacggtgatcgacgcgtactgtcgccagtgcgcgatcgagatgaactgcatcgaa
ctcgcgcaggccgcgctgtttctcgcgaacggcggcgtcgcgcccgtcaccggcgagcgg
atcgtcgatgcgagctcggccaagcggctgtcggcgctgatgctgacctgcggcacctat
gacgcggcgggggatttcgtctatcgggtcgggctgccggcgaagagcggcgtgggcggc
gggatcgtcgcggtgctgccgggggaaatggccgtttgcgtgtgggcgccggggctcgat
gcgaatgggaattcgttggcggggacgctggctctcgaatggctgaccacgtattcgggg
cggtcgattttttga

DBGET integrated database retrieval system