KEGG   Burkholderia vietnamiensis G4: Bcep1808_3641Help
Entry
Bcep1808_3641     CDS       T00493                                 

Definition
(GenBank) short-chain alcohol dehydrogenase
  KO
K00209  enoyl-[acyl-carrier protein] reductase / trans-2-enoyl-CoA reductase (NAD+) [EC:1.3.1.9 1.3.1.44]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00061  Fatty acid biosynthesis
bvi00650  Butanoate metabolism
bvi01100  Metabolic pathways
bvi01120  Microbial metabolism in diverse environments
bvi01200  Carbon metabolism
bvi01212  Fatty acid metabolism
Module
bvi_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    Bcep1808_3641
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    Bcep1808_3641
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:bvi01004]
    Bcep1808_3641
Enzymes [BR:bvi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     Bcep1808_3641
    1.3.1.44  trans-2-enoyl-CoA reductase (NAD+)
     Bcep1808_3641
Lipid biosynthesis proteins [BR:bvi01004]
 Fatty acid synthase
  Component type
   Bcep1808_3641
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Enoyl_reductase Eno-Rase_NADH_b Eno-Rase_FAD_bd
Motif
Other DBs
NCBI-ProteinID: ABO56626
UniProt: A4JK23
Position
2:381075..382277
Genome map
AA seq 400 aa AA seqDB search
MIIKPRVRGFICVTTHPVGCEANVKEQIDYVTSHGPIANGPKKVLVIGASTGYGLAARIS
AAFGSGADTLGVFFERAGSDTKPGTAGWYNSAAFEKFAAEKGLYARSINGDAFSDKVKQI
TIDTIKQDLGKVDLVVYSLAAPRRTHPKTGETISSTLKPVGKSVTFRGLDTDKETIREVT
LEPATQEEIDGTVAVMGGEDWQMWIDALADAGVLADGAKTTAFTYLGEQITHDIYWNGSI
GEAKKDLDKKVVSIREKLAVHGGDARVSVLKAVVTQASSAIPMMPLYLSLLFKVMKEKGT
HEGCIEQVYGLLKDSMYGATPHIDEEGRLRADYKELDPQVQAQVVAMWDKVTNDNLYEMT
DFAGYKTEFLRLFGFEIAGVDYDADVNPDVKIPGIIDTTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgatcatcaaaccgcgcgtgcgtggcttcatctgcgtgaccactcatccggtcggctgc
gaggccaacgtcaaggaacagatcgactacgtgacttcgcacggcccgatcgccaacggc
ccgaagaaggtgctcgtgatcggcgcgtcgaccggctacggcctcgcggcccggatctcg
gccgccttcggctcgggcgcggacacgcttggcgtgttcttcgagcgcgccggcagcgac
accaagccgggcaccgccggctggtacaacagcgccgcgttcgagaaattcgccgccgaa
aaggggctctatgcgcgcagcatcaacggcgacgcgttctccgacaaggtcaagcagatc
acgatcgacacgatcaagcaggacctcggcaaggtcgatctggtcgtctacagcctggcc
gcgccgcgccgcacgcatccgaagacgggcgagacgatcagctcgacgctgaagccggtc
ggcaagtcggtgacgttccgcggcctcgacaccgacaaggaaacgatccgcgaggtgacg
ctcgagccggcgacgcaggaagagatcgacggcaccgtcgccgtgatgggcggcgaggac
tggcagatgtggatcgacgcgctcgccgacgccggcgtgctggccgacggcgcgaagacc
accgcgttcacgtatctcggcgagcagatcacgcacgacatctactggaacggctcgatc
ggtgaggcgaagaaggatctcgacaagaaggtcgtgtcgatccgcgagaagctcgccgtg
catggcggcgacgcgcgcgtgtcggtgctgaaggccgtcgtcacgcaggcgagctcggcg
atcccgatgatgccgctgtacctgtcgctgctgttcaaggtgatgaaggaaaagggcacg
cacgaaggctgcatcgagcaggtgtacgggctgctgaaggacagcatgtacggcgcgacg
ccgcacatcgacgaagaaggccggctgcgcgcggactacaaggaactcgatccgcaggtg
caggcgcaggtcgtcgcgatgtgggacaaggtcacgaacgacaacctgtacgagatgacc
gacttcgccggttacaagaccgagttcctgcgtctgttcggcttcgagatcgccggcgtc
gactacgacgcggacgtgaacccggacgtgaagatccccggcatcatcgacacgacggcc
tga

DBGET integrated database retrieval system