KEGG   Burkholderia vietnamiensis G4: Bcep1808_3839Help
Entry
Bcep1808_3839     CDS       T00493                                 

Definition
(GenBank) L-arabinonolactonase
  KO
K13874  L-arabinonolactonase [EC:3.1.1.15]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00053  Ascorbate and aldarate metabolism
bvi01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    Bcep1808_3839
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.15  L-arabinonolactonase
     Bcep1808_3839
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SGL Phytase-like PD40
Motif
Other DBs
NCBI-ProteinID: ABO56822
UniProt: A4JKL9
Position
2:597485..598387
Genome map
AA seq 300 aa AA seqDB search
MQQTHPGAAAQLLVDSRNTLGEGATWCDATHTLYWTDIEGARLWRCRADGSELAQWPMPE
RLACFALTQEPDVLLVGLATHLAFFDLRSGTFTRIVDVEPDLPTRLNDGRCDPFGAFVFG
MKDEGGEPPRALGGFYRLDADLTLERLALPPAAIANSIAFSPDGAKMYFCDSLVREIFVC
DYRAGGDVANVRAFARLTDAHGDPDGSTVDRDGGLWNAQWGGRRVVRYGPDGVETDRVAV
PTAQPSCAALDGEGRLYVTSARVGLDDAALADDAAAGGVFVAATRYAGLPTARFAGKRAR
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgcaacagactcatccgggcgcggcggcccagctgctggtggacagccgcaatacgctc
ggcgaaggcgcgacgtggtgcgacgcgacgcacacgctgtactggacggacatcgaaggc
gcgcggctgtggcgctgccgcgcggacggctccgagctcgcgcagtggccgatgcccgaa
cggctcgcgtgcttcgcgctcacgcaggagcccgacgtgctgctggtcgggctcgcgacc
catctcgcgttcttcgatctgcgcagcggcacgttcacgcggatcgtcgacgtcgagccc
gatctgccgacgcggctgaacgacggccgctgcgatccattcggtgcgttcgtgttcggc
atgaaggacgagggcggcgagccgccgcgcgcgctcggcgggttctaccggctcgatgcc
gatctcacgctcgagcggctcgcgttgccgcccgcggcgatcgcgaacagcatcgcgttc
tcgccggacggcgcgaagatgtatttctgcgattcgctggtgcgcgagatcttcgtctgc
gattaccgcgcgggcggcgacgtggccaacgtgcgcgcgttcgcgcggctgaccgatgcg
cacggcgatcctgacggctcgacggtcgaccgcgacggcgggctgtggaacgcgcagtgg
ggcggcaggcgcgtggtgcgctacgggccggacggcgtcgagaccgaccgcgtcgccgtg
ccgaccgcgcagccgagctgcgcggcgctcgacggcgaaggccggctgtacgtgaccagc
gcgcgcgtcgggctcgacgacgcggcgcttgccgacgatgccgcagccggcggcgtgttc
gtcgccgcgacgcgctacgcggggctgccgaccgcgcgcttcgcgggcaagcgcgcgcgc
tga

DBGET integrated database retrieval system