KEGG   Burkholderia vietnamiensis G4: Bcep1808_4015Help
Entry
Bcep1808_4015     CDS       T00493                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00071  Fatty acid degradation
bvi00072  Synthesis and degradation of ketone bodies
bvi00280  Valine, leucine and isoleucine degradation
bvi00310  Lysine degradation
bvi00362  Benzoate degradation
bvi00380  Tryptophan metabolism
bvi00620  Pyruvate metabolism
bvi00630  Glyoxylate and dicarboxylate metabolism
bvi00640  Propanoate metabolism
bvi00650  Butanoate metabolism
bvi00900  Terpenoid backbone biosynthesis
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01130  Biosynthesis of antibiotics
bvi01200  Carbon metabolism
bvi01212  Fatty acid metabolism
bvi02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bcep1808_4015
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep1808_4015
   00640 Propanoate metabolism
    Bcep1808_4015
   00650 Butanoate metabolism
    Bcep1808_4015
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bcep1808_4015
   00072 Synthesis and degradation of ketone bodies
    Bcep1808_4015
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bcep1808_4015
   00310 Lysine degradation
    Bcep1808_4015
   00380 Tryptophan metabolism
    Bcep1808_4015
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bcep1808_4015
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bcep1808_4015
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bcep1808_4015
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bvi04147]
    Bcep1808_4015
Enzymes [BR:bvi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bcep1808_4015
Exosome [BR:bvi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bcep1808_4015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ABO56996
UniProt: A4JL43
Position
2:798893..800077
Genome map
AA seq 394 aa AA seqDB search
MVARQVVICSPVRTPIGAFGGTLKDVAATALGAAALREAVRRSEIDPAELASVVMGNVVQ
AGNKMNPARQAAVAGGIPVTVPALTVNRVCGSGAQAIANAAQDIWLGFGEVAAAGGMENM
DGAPYLLGGGRWGYRMGNAEIADSMLVDGLVDAFSNLHSGWHTEDLVAMKGITREQQDRW
AERSQRRFADAQARGAFDAELVAVEVAGRKQTVRFERDEQPRPDTNFESLARLKPAFRAD
GTITAGNAPGLNSGAAAMIVAERRYAETRGIEPIATLVSYGVGAVEPGLFGLGPVPAVKM
ALARAGWSMNDVERFEINEAFAAVPIAVARELGIDEERINVEGGAIAHGHAIGATGAVLT
TRLAHSMRRDGIKRGIVTLCIGGGQGIALALEAV
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atggttgctcgacaggtagtgatctgcagtcccgtccggacgccaatcggcgcgttcggc
ggcacgttgaaggacgttgcggcgacggcgctcggcgcggccgcgttgcgcgaagcggtg
cgtcgcagcgagatcgatccggcggagctggcgtcggtcgtgatgggcaacgtcgtgcag
gccggcaacaagatgaatcccgcgcgtcaggcggccgtcgcgggcggcattcccgtgacc
gtgcccgcgctgacggtcaatcgcgtgtgcggctccggtgcgcaggccatcgcgaatgcg
gcgcaggacatctggctcggcttcggcgaggttgcggcggcaggcggaatggagaacatg
gacggcgcgccgtatctgctcggcggcggccgttggggctatcggatgggcaatgccgag
atcgccgacagcatgctcgtggatggcctcgtcgatgcgttctccaacctgcattcggga
tggcacacggaagacctcgtcgcgatgaaggggatcacgcgcgagcagcaggaccgctgg
gcggaacgttcgcaacggcgcttcgccgacgcgcaggcgcgtggggcattcgacgccgaa
ctggtggcggtcgaggtcgcggggcgcaagcagaccgtccgattcgagcgcgacgagcag
ccgcgcccggacacgaacttcgagtcgcttgcgaggctgaagcccgcatttcgcgctgac
ggcaccatcaccgccggcaatgcgcccggcctgaacagcggtgcggcggcgatgatcgtg
gccgagcggcgttatgccgagacgcgcggcatcgagccgatcgccacgctcgtctcgtac
ggcgtgggggcggtcgagccgggcctgttcggactcgggccggtgccggcagtgaagatg
gcgctcgcgcgtgccgggtggtcgatgaacgacgtggagcggttcgagatcaacgaggcc
tttgccgccgtgccgatcgcggtcgcgcgcgagctcggcatcgacgaagagcggatcaac
gtcgaaggcggcgcgatcgcgcacggtcacgcgatcggcgcgaccggtgccgtcctgacc
acccgtcttgcacattcgatgcgccgcgacggcatcaagcgcggcatcgtgaccttgtgc
atcggcggcggccagggcatcgctctcgcgctcgaagccgtctga

DBGET integrated database retrieval system