KEGG   Burkholderia vietnamiensis G4: Bcep1808_4427
Entry
Bcep1808_4427     CDS       T00493                                 

Definition
(GenBank) conserved hypothetical protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB
Motif
Pfam: PAAR_motif
Other DBs
NCBI-ProteinID: ABO57393
UniProt: A4JM90
Position
2:complement(1253782..1254060)
AA seq 92 aa
MSKIMMALKGNTTTTGGVVLDGDGAMLDDGVPLAKHMGLASCPRCGQNGPIFGTALSWGL
TSTRGVRDNDIVMCRCPPGTNRVIARSTIYDE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgagcaagatcatgatggccctgaagggcaatacgaccacgaccggtggtgtcgtgctt
gacggtgacggggccatgctggatgacggcgtgccgctcgcaaaacatatggggctggcg
tcatgcccgcgctgcggtcagaacgggcccattttcggaacggcattgagctggggactg
acgagcacgcggggcgtgcgcgacaacgacatcgtgatgtgccgatgcccgcccgggacc
aaccgcgtcatcgcacgctcgaccatttacgacgagtag

DBGET integrated database retrieval system