KEGG   Burkholderia vietnamiensis G4: Bcep1808_4442Help
Entry
Bcep1808_4442     CDS       T00493                                 

Definition
(GenBank) protein of unknown function DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_4442
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_4442
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: ABO57408
UniProt: A4JMA5
Position
2:1275306..1277120
Genome map
AA seq 604 aa AA seqDB search
MTNPIKDNEILRYYEAEMRYLRDAGREFADAFPDRARELGLDRGGERDPHVERLLEGFAF
LMGRLRHKLDDELPELTEGLVSMLWPHYLRMIPSLSILELTPDMGALQKHETLGAGLEVT
SGPIATGHTDGAPAHVECVYRTTQPIDLYPITLTDAGAWAREDGRSVIRLRLAIQPQAQR
ERLHVPRLRLYLDADRPIALALHAALTAKPLAMHVRVPGFPEDRPGAPQDIPGLRIEAAG
YAGNERLWPKADNAFGGYQLLLEYFTFPEKFMFVDLLGLDIQALPPSAPHVDVEIVLAKP
WQDDMRFNAQNVRLYCTPIINLFPVQADPVKVTQFETEYRVRAREQHGPLVDIYSIDAVH
GIDRGRRFEYAPFAAFRHRGGMLRHTMPERYFHSHVRRAPSGRFDTWVVLGGHAWESEHA
LPAETLSLSVTGTNGMLPRKALRDASITRMRAGFTNIAAVRNLTAPTLPVYPPTGDRFQW
RVLSHLAPNYLSLLDAEILRGSLALYDWTDGELNRRRIEAITDVRHRPLQKLVKGGLMRG
VEIAVTIDSTRFAGNGDLELFGAMLNRFLGLYATVNLYTKLVIVSQPTGQRLEWPDTKGE
GAPF
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgacgaatccgatcaaggataacgagatcctgcgctattacgaggcggagatgcgctat
ttgcgcgacgccggccgggagtttgccgatgcatttcccgatcgcgcgcgcgagctgggc
ctggatcgcggaggcgagcgcgaccctcatgtggaacggctgctcgaaggcttcgcgttc
ctgatgggccgcctgcgtcacaagctcgacgacgagctgcccgagctgaccgaagggctc
gtcagcatgctgtggccgcactatctgcgcatgattccgtcgctgtcgatcctcgagctc
acgccggacatgggtgcgctgcaaaagcacgagacgctcggcgccggcctcgaggtgacg
tccggaccgatcgcgacgggccacacagacggcgcacccgcacacgtcgaatgcgtgtac
cgcacgacgcagccgatcgatctctacccgatcacgctcaccgacgcaggcgcgtgggcg
cgcgaagacggtcgctcggtcatccggttgcgcctggcgattcagccacaagctcagcgt
gaacgactgcatgtaccgcgactgcggctgtatctcgacgcggaccggccgattgcgctc
gcactgcatgccgcgttgacggcgaaaccgctggcaatgcacgtgcgtgtgcccggtttc
ccggaagatcgccccggtgcgcctcaagatataccggggcttcggatcgaggcggccggc
tacgcgggcaacgaacgtctgtggccgaaggccgacaacgcgttcggcggctaccaattg
ctgctggagtacttcacgttccccgagaagttcatgttcgtcgacctgctcgggctcgac
atccaggcgcttccaccgtccgcgccgcatgtcgacgtcgagatcgtgctggcaaagccg
tggcaggacgacatgcgtttcaacgcgcagaacgtgcggctctactgcacgccgatcatc
aacctgtttcccgttcaggccgatccggtcaaggtcactcagttcgagaccgagtaccgg
gtacgggcgcgcgagcagcacggcccgttggtcgatatctactcgatcgacgcggtgcac
ggcatcgatcgcggccgacgcttcgaatatgcgccgttcgcggcattccgccatcgtggc
ggcatgctgcgccatacgatgcccgagcgatatttccattcgcacgtgcgacgcgcgcct
tccggacggttcgatacgtgggtcgtgctgggcggccacgcttgggaaagcgagcatgcg
ctgcccgcggaaacgctgtcgctgtcggtgacgggcaccaacggcatgctgccgcgcaag
gcgctgcgcgatgccagcatcacgcggatgcgcgcgggcttcaccaacatcgcggcagtg
cgcaatctgaccgcaccgacgctgccggtctacccgccgaccggcgatcgcttccaatgg
cgtgtgctgtcccatctggcgccgaactatctgtcgctgctcgatgcggaaatcctgcgc
ggctcgctcgcgttgtacgactggacggacggggagttgaaccggcgtcgcatcgaggcg
atcaccgacgtgcgtcaccggccattgcagaagctcgtgaagggcggcctgatgcgcggc
gtcgagattgcggtgacgatcgacagcacacgtttcgcgggcaacggcgatctcgagctg
ttcggcgccatgctgaaccggttcctcggcctctatgcgacggtcaacctgtacacgaag
ctcgtcatcgtgtcgcagccgaccggtcagcggctcgaatggcccgatacgaagggcgaa
ggagcgccgttttga

DBGET integrated database retrieval system