KEGG   Burkholderia vietnamiensis G4: Bcep1808_4443
Entry
Bcep1808_4443     CDS       T00493                                 

Definition
(GenBank) protein of unknown function DUF1305
  KO
K11895  type VI secretion system protein ImpH
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_4443
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_4443
SSDB
Motif
Pfam: T6SS_TssG
Other DBs
NCBI-ProteinID: ABO57409
UniProt: A4JMA6
Position
2:1277183..1278199
AA seq 338 aa
MLLPALLDQAHRMNFYRFCALIELASPDAAPLGATDSPATDPVRFRSRGQLGFPAREIDA
VEYDADDPAKPVAVRTTFLGLYGVDARMPTYFVDEVAQNRDGAEPLSAFLDLFHHRIATQ
FYRIWRKYRYPAGFRPDGFDTVSRGVLSFVGLGFRSPDTHAPDWGLPQGVGARTLLSMLG
LAAQKTRTAEGLAGVLTHAIPDAAIDVEEFYPVWRTVNDFEPAALGEQCLLGRGFYDRAN
TVRIVITPHTRESVTALVPGQPAYRQITALLRFYLGYESEALLEMQVHPDLMPEPLLAAG
QANLGLTTQLGSPPAVGRGPTRVTRVQLGRWSGATETV
NT seq 1017 nt   +upstreamnt  +downstreamnt
atgttgttgccggcgctgttggatcaggcgcatcggatgaatttctatcgcttctgcgcg
ttgatcgaactggcgtcacccgatgcagcgccgctcggcgccaccgattcgcccgcgacg
gatccggtccggttccgctcacgtggccaacttgggtttccggcgcgcgagatcgatgca
gtcgaatacgacgcggacgatccggcgaagccggttgcggtgcgtacgacgttcctcggt
ctgtacggcgtcgacgcgcggatgccgacgtacttcgtcgacgaagtggcgcagaaccgc
gacggcgccgagccgctgtcggcgttcctggacctgttccaccatcgtattgcgacgcag
ttctaccggatttggcgcaagtatcgctatccggccggtttccggccggatggcttcgac
acggtctcccgcggtgtgctcagctttgtcggtcttgggttccggtcgccggacacacat
gcgcctgactgggggctgccgcagggcgttggtgcgcgaacgctgctgtcgatgctcgga
ctagccgctcagaagacgcgtaccgcggaagggctcgccggcgtgctgacacatgcgata
ccggatgccgcgatcgacgtcgaggagttctatccggtgtggcgtaccgtcaacgatttc
gagcctgcagcgctcggcgaacaatgtctgctcggacgcggattctacgatcgggcgaac
acggtacgcatcgtgatcacgccgcacacgcgcgaatcggtcaccgcgctggtgcccggg
caaccggcataccgacagatcaccgcgttgctgcgcttctacctcggctacgaaagcgaa
gcgctgctcgagatgcaggtgcatcctgacctgatgccggaaccgttgttggccgccggt
caggcgaacctcggcctgaccacgcagctcgggtcgccgcctgcggtagggcgcggaccc
actcgcgtgacacgggtgcagttggggcgctggagcggggcgacggaaaccgtataa

DBGET integrated database retrieval system