KEGG   Burkholderia vietnamiensis G4: Bcep1808_4475Help
Entry
Bcep1808_4475     CDS       T00493                                 

Definition
(GenBank) polysaccharide biosynthesis protein
Organism
bvi  Burkholderia vietnamiensis G4
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Polysacc_synt Polysacc_synt_3 MatE
Motif
Other DBs
NCBI-ProteinID: ABO57440
UniProt: A4JMD7
Position
2:1315954..1317420
Genome map
AA seq 488 aa AA seqDB search
MDKGILKNVSINFIGLILPTFVSLVTVPAYIHALGVERYGVVSLVWTLIGYFGILDLGMS
MAAQNHISKALASGDAAESARVFWSAFWLNLGTGIAGGLLIYFGAFVYTAYFTKVSAAMQ
HEVYLALPWLALAIPLANVSWVFAGAINGAERFGVFNTNQTIGTFLFQLLPLGAAWWIAP
NLQTVLAAAVVARLIAAVMLGHASIKVLGIRRIDPPQWGTAKGLFNFGGWMLIASMASMI
ADTLDRVMLGAGMGAKFVTYYTVPQNLVTRLNMLPNALVRTLFPRLSAVGRDHADTLARQ
SLEFLNGVFTPVGIVAIFALAPFLTLWVGADLAAHSAPVGRVLVISVWLVGQASVTRILI
QSQVNPARAAFAGLVEMPFFVGALWFGIHHFGLIGAAVVVAVRALVDYGVLLYLSAIRMR
AIVLDMLAHLAFLLASLLLAQTWSGLGESIGLCAVVLVLNLAWSLTMTPGLRALVRDLFV
RLNARKTV
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaggcatactcaagaacgtttcgatcaacttcatcgggctgatcctgccgacc
ttcgtgtcgctggtcacggtgcctgcgtacatccatgcactcggcgtggagcgctacggc
gtcgtcagcctcgtgtggacgctgatcggttatttcgggatcctcgatctcgggatgagc
atggccgcgcagaaccacatctcgaaggcgctcgcgagcggcgatgcggccgaaagcgcg
cgcgtgttctggagcgcgttctggctcaatctcggcaccggcatcgcgggcggcctgctg
atctacttcggcgcgttcgtctataccgcgtacttcacgaaggtgtcggcggcgatgcag
cacgaggtgtatctcgcgctgccgtggctcgcgctcgcgattccgctcgcgaacgtgtcg
tgggtgttcgccggcgcgatcaacggcgcggaacgcttcggcgtgttcaacacgaaccag
acgatcggcacgttcctgttccagctgttgccgctcggcgccgcgtggtggatcgcgccg
aacctgcagacggtgctcgccgcggcggtggtcgcgcggctgatcgcggcggtgatgctc
ggccacgcgagcatcaaggtgctcggcatccgccgcatcgatccgccgcagtggggcacc
gcgaaagggctgttcaacttcggcggctggatgctgatcgcgagcatggccagcatgatc
gccgacacgctcgaccgcgtgatgctcggcgccggcatgggcgcgaagttcgtcacctac
tacaccgtgccgcagaacctcgtcacgcggctcaacatgctgccgaacgcgctggtgcgc
acgctgtttccgcgcctgtcggcggtcggccgcgatcacgccgacacgctcgcgcgccag
tcgctcgaattcctgaacggcgtgttcacgccggtcggcatcgtcgcgatcttcgcgctc
gcgccgttcctgacgctgtgggtcggcgccgatctcgccgcgcattcggcgccggtcggg
cgcgtgctggtgatcagcgtgtggctcgtcgggcaggcgagcgtcacgcgcatcctgatc
cagtcgcaggtcaatccggcgcgcgccgcgttcgcggggctcgtcgaaatgccgttcttc
gtcggcgcgctgtggttcggcattcatcacttcgggctgatcggcgcggcggtggtcgtc
gccgtgcgcgcgctggtcgactacggcgtgctgctctacctgtcggccatccggatgcgc
gcgatcgtgctcgacatgctcgcgcacctcgccttcctgctcgcgagcctgctgctcgcg
caaacatggtcggggctcggcgagtcgatcggcctgtgcgccgtcgtgctcgtgctgaac
ctggcgtggtcgctcacgatgactcctgggctgcgcgcgctcgtgcgcgacctgttcgtc
cgtctcaatgcgaggaaaaccgtatga

DBGET integrated database retrieval system