KEGG   Burkholderia vietnamiensis G4: Bcep1808_4997Help
Entry
Bcep1808_4997     CDS       T00493                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00630  Glyoxylate and dicarboxylate metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
bvi01120  Microbial metabolism in diverse environments
bvi01200  Carbon metabolism
Module
bvi_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bcep1808_4997
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bcep1808_4997
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABO57953
UniProt: A4JNV0
Position
2:complement(1886927..1888513)
Genome map
AA seq 528 aa AA seqDB search
MSQYQDDIKAVAGLKENHGSAWNAINPEYAARMRAQNKFKTGLDIAKYTAKIMRADMAAY
DADPSKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDAAAKAAIQQKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNAPGDLGDQYNSFLDCEELSGDQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRAGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIAG
MVNEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDALKAEGKDVSAYDRAQLMSVEYDDTE
LAKLADDKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGEQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQFS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggcttgaaggaaaaccacggcagc
gcgtggaatgccatcaatcccgagtatgccgctcgcatgcgcgcccagaacaagttcaag
acgggcctcgacatcgcgaagtacaccgcgaagatcatgcgcgccgacatggctgcgtac
gacgcggatccgtccaagtacacgcagtcgctcggttgctggcacggcttcatcggccag
cagaagatgatttccattaagaagcacttcaacagcaccgaacgccgctacctgtacctg
tcgggctggatggtcgctgcgctgcgctcggagttcggcccgctgccggaccagtcgatg
cacgaaaagacgtcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgagctcggcggcctgttccgcgagctggatgccgcgaaggacgccgctgcg
aaggccgcgatccagcaaaagatcgacaaccacgtgacgcacgtcgtgccgatcatcgcc
gacatcgacgccggtttcggcaacgctgaagcgacctatctgctggccaagcagttcatc
gaagcgggcgcatgctgcatccagatcgagaaccaggtgtcggacgagaagcagtgcggc
caccaggacggcaaggtcacggtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcattcctggagctgggcgtggatgacggcatcatcgtcgcgcgcaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgacgaacgcgccgggcgacctgggcgac
cagtacaactcgttcctcgactgcgaagaactgtcgggcgaccagctcggcaacggcgac
gtcgtgatcaagcgcgacggcaagctgctgcgtccgaagcgcttgccgagcaacctgttc
cagttccgcgccggcacgggtgaagcacgttgcgtgctggattgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgagaccgaaaagccgcacatcgcgcagatcgccggc
atggtcaacgaaatccgcaaggtgatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggtgtacgacgcgctgaaggccgaaggc
aaggacgtgtcggcatacgaccgtgcgcaactgatgagcgtcgaatacgacgacaccgaa
ctggcgaagctcgcggacgacaagatccgcacgttccaggccgatgcgtcgcgtgaagcc
ggcatcttccatcacctgatcacgctgccgacgtaccacacggccgcactgtcgaccgac
aacctcgcgaaggaatacttcggcgaacaaggcatgctcggctacgtggccggcgtgcag
cgcaaggaaatccgtcagggcatcgcgtgcgtgaagcaccagaacatgtcgggttcggac
atcggcgacgatcacaaggaatacttcagcggtgaagccgcgctgaaggcagcgggcaag
gacaacacgatgaaccagttctcgtaa

DBGET integrated database retrieval system