KEGG   Burkholderia vietnamiensis G4: Bcep1808_5148Help
Entry
Bcep1808_5148     CDS       T00493                                 

Definition
(GenBank) protein of unknown function DUF876
  KO
K11893  type VI secretion system protein ImpJ
Organism
bvi  Burkholderia vietnamiensis G4
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_5148
Secretion system [BR:bvi02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   Bcep1808_5148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_VasE
Motif
Other DBs
NCBI-ProteinID: ABO58099
UniProt: A4JM93
Position
2:2060482..2061828
Genome map
AA seq 448 aa AA seqDB search
MKITRPLWAKGIFMTPQHFQQQAIWEQYVHDRVARIASPDAWGAVHVALDSEALSVNRLQ
CTALGLRLPDGTLIDSETADWLPAARSLDDVPTTVDSVTVLAGVALMDAQGGNCVEPGEK
PARPRRVTREYKHVADLNGDGQEEISVERNVVALLFDFEQAGDYVTCPIARLVRTPQGRF
EQDKSFVPPCLFLSASDRLVHRAQRISEILSAKSASLAVRRKERSDQIADFAVSDVALFW
LLHSVNSTWPELARLVQAPDQHPERLYAVLARLAGSLLTFSTTESLQAIPLYDHHAPEPM
FAELESLIRTLLDAVIPSRVVPIALERVRATTWLGRINDERLTEGAEYYLSVQAAMPAHA
LIEHLPRLCKVGAPDEVEQIVNSALLGIALRPMSRLPAAIPVRIENQYFALDSNDAAFKR
MIDAHACQIYVPASIPEASLELYAVLPS
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgaagataaccagaccgctgtgggccaaggggattttcatgacgccgcagcacttccag
cagcaggcgatatgggaacaatacgtccatgaccgtgtagcacgtatcgcgagccccgac
gcttggggtgccgtccacgttgcgctcgacagcgaagcactgagcgtcaatcgactgcag
tgcacggcgctcgggctgcgcctgccggacggtacgctgatcgatagtgaaacggccgac
tggcttcctgcggcacgcagtctcgacgacgtgccgacaacggtcgacagcgtgaccgtg
cttgctggtgtagcactgatggacgctcagggcggcaactgcgtcgaacccggcgaaaag
cctgcgcggccgcggcgcgtgacccgcgaatacaagcacgttgccgatctgaacggcgac
ggacaggaagaaatcagtgtcgagcgcaacgtggtagcccttctgttcgacttcgagcag
gccggagactacgtcacctgtccgatcgcgcggctcgtgcgcacgccacaagggcggttc
gaacaggacaagagcttcgtcccgccgtgcctgttcctgtcggcgagcgatcgcctcgtg
catcgcgcgcagcgcatctccgaaatcctgtctgccaagagcgccagccttgcggtgcgc
cgcaaagagcgctcggatcagatcgccgatttcgccgtgtccgacgtggcgctcttctgg
ctgttacatagcgtgaatagcacgtggcccgaactcgcccgtctcgtacaggcgccggac
cagcatccggaacggctctacgccgtgctcgcccgcttggccggctcactgctgacgttc
tctacgaccgagtcgctccaggcgattccgctatacgatcaccacgcaccggagccgatg
tttgccgagctcgaatcgctgatcagaacactgctcgacgccgtgattccgtcccgagtc
gtgccgattgcactcgagcgcgtgcgcgcgaccacatggctcggccgaatcaacgacgag
cggctgacggaaggcgctgaatactatctgtcggttcaggccgccatgcccgcacacgcc
ctcatcgagcacctgccgcgcctctgcaaggtcggcgcaccggacgaagtcgagcagatc
gtcaattccgcactgctcggcatcgcactgcgaccgatgtcgcgcctgcctgccgcgatt
cccgtgcggatagaaaaccagtacttcgcgctggacagcaacgatgccgcgttcaagcgg
atgatcgacgcgcatgcctgccagatctacgtgccggcgtcgattcctgaagcgtcgctc
gagctgtatgcggtgctgccgtcatga

DBGET integrated database retrieval system