KEGG   Burkholderia vietnamiensis G4: Bcep1808_5742Help
Entry
Bcep1808_5742     CDS       T00493                                 

Definition
(GenBank) phosphatidylserine decarboxylase-related protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00564  Glycerophospholipid metabolism
bvi01100  Metabolic pathways
bvi01110  Biosynthesis of secondary metabolites
Module
bvi_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bcep1808_5742
Enzymes [BR:bvi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     Bcep1808_5742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase PSDC
Motif
Other DBs
NCBI-ProteinID: ABO58679
UniProt: A4JQX6
Position
3:complement(327801..328667)
Genome map
AA seq 288 aa AA seqDB search
MFRDAAVNAQLKQVLNVWCDFLGGPHSRAHLDTSAPNGWFCEAAHKRLGLSQFEYREDQP
HWGFDSWNDFFTRRFRAGMRPVAAPGDSHVIVSPCESTPYHTASNVKIRDTFWIKGQPYS
LRDIFTPAWQPLAERFVGGEIYQAYLAAYNYHRWHAPVRGTVTHAYRVEGAYYSVAEAEG
PDPAGLNDSQGYMTAVAARAIVAIDSDDPGIGTVAAVFIGMGDVSSCVIEVVPGQRVDKG
EEIGYFQFGGSTCCLVFEPGVIDRFVHAPPFDGEPPVVKVNDSVAIAR
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
gtgtttcgcgacgcggcggtcaacgcgcagttaaagcaggtgctgaacgtgtggtgcgac
ttcctcggcggcccacattcgcgcgcgcatctcgacacgtccgcgccgaacggctggttc
tgcgaggccgcgcacaagcgcctcggtctgtcgcagttcgagtaccgcgaagatcagccg
cactggggcttcgattcgtggaacgacttctttacgcggcgttttcgcgccgggatgcgg
ccggtcgcagcgcccggcgattcacacgtgatcgtgagcccctgcgaatccacgccgtac
cacaccgcgtcgaacgtgaagattcgcgacacgttctggatcaaggggcaaccgtattcg
ttgcgcgacatcttcacgccggcgtggcagccgctggccgagcgcttcgtcggcggcgag
atctatcaggcctatctggccgcgtacaactatcaccgctggcatgcgccggtgcgcggc
accgtcacgcacgcgtaccgcgtggaaggcgcgtattactccgtcgccgaagcggaaggc
cccgatccggccgggctcaacgactcgcagggctatatgacggccgtggccgcgcgcgcg
atcgtcgcgatcgacagcgatgatccgggcattggcaccgtcgcggcggtgttcatcggg
atgggcgacgtgtcgtcgtgcgtgatcgaggtggtgccggggcagcgcgtcgacaagggc
gaggagatcggatatttccagttcggcggctcgacctgctgcctggtgttcgagccgggc
gtgatcgaccgcttcgtgcacgcgccgccgttcgacggcgaaccgccggtcgtgaaggtc
aacgattccgtggcgatcgcgcgttga

DBGET integrated database retrieval system