KEGG   Burkholderia vietnamiensis G4: Bcep1808_5784
Entry
Bcep1808_5784     CDS       T00493                                 
Name
(GenBank) type IV secretory pathway, VirB3 family protein
  KO
K03198  type IV secretion system protein VirB3
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:bvi00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    Bcep1808_5784
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bvi02044]
    Bcep1808_5784
Secretion system [BR:bvi02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   Bcep1808_5784
SSDB
Motif
Pfam: VirB3 RseC_MucC
Other DBs
NCBI-ProteinID: ABO58716
UniProt: A4JR13
Position
3:365490..365810
AA seq 106 aa
MHSLKDPVFKGCTRPAMLWGVPLVPLLMIGGSMLIPAIWALLASPALGVGILLLMIPVFV
AMRMTTRHDDQRLAQHARRARMALRQGNRRFWGAHAYVPVRLKRRA
NT seq 321 nt   +upstreamnt  +downstreamnt
atgcattcgctcaaggatcctgtcttcaaaggctgcacgcgtcccgcgatgctctggggt
gtgccgctggtgcccttgctgatgatcggcggcagtatgctgattcccgcgatctgggca
ttgctggccagccctgcgctgggtgtcgggatcctccttttgatgattccggtgttcgtc
gcgatgcggatgacgacgcgccacgacgatcaacggcttgcgcagcatgcgcggcgcgct
cgcatggcgttgcgtcagggcaaccgccgcttctggggcgcacacgcctatgtgccggtg
cgcctgaagaggagggcatga

DBGET integrated database retrieval system