KEGG   Burkholderia vietnamiensis G4: Bcep1808_5901Help
Entry
Bcep1808_5901     CDS       T00493                                 

Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
bvi  Burkholderia vietnamiensis G4
Pathway
bvi00790  Folate biosynthesis
bvi01100  Metabolic pathways
Module
bvi_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bvi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bcep1808_5901
Enzymes [BR:bvi01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bcep1808_5901
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: ABO58829
UniProt: A4JRC6
Position
3:complement(493339..494070)
Genome map
AA seq 243 aa AA seqDB search
MGNVIDAPEHTLTAIDEGIPLSQLIRRRLEHAGARFHANDNIAAHLRDGELDALQSEVAQ
RMEAVLRSLVIDVDHDHNTRDTARRVAKMFVREVFAGRYEAPPPVTEFPNVERLDELLIV
GPLRVRSACSHHLCPIMGRIWIGVLPSATSNLIGLSKYGRLVNWVMARPQIQEEAVKQIA
DLLERRIAPDGLAVVLEADHFCMHWRGTKDDQAKMTNSVMRGKFLADASLRREFLALLSG
KDA
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatgtaatcgacgcgcccgagcacacgttgaccgcgatcgacgagggcattcct
ctgtcgcaactgattcgtcgtcggctcgagcatgcgggcgcgcgctttcatgcgaacgac
aacatcgccgcgcacctgcgcgacggcgagctcgacgcgctgcagagcgaagtcgcacag
cggatggaagcggtgctgcgctcgctcgtcatcgacgtcgatcacgaccacaacacgcgc
gacaccgcgcggcgcgtcgcgaagatgttcgtccgcgaagtgtttgcaggccgttacgag
gcaccgccgcccgtcaccgagttccccaacgtcgagcggctggacgaactgctgatcgtc
ggcccgctgcgcgtacgcagcgcgtgttcgcatcatctctgcccgatcatggggcggata
tggatcggcgtgctgccgagcgccacgtcgaatctgatcggcttgtcgaagtatggccgg
ctcgtgaactgggtcatggcgcgcccgcagattcaggaggaggcggtcaagcagatcgcc
gacctgctcgaacggcgcatcgcgcccgacgggcttgccgtcgtgctcgaagccgaccac
ttctgcatgcactggcgcggcaccaaggacgaccaagcgaagatgaccaacagcgtgatg
cgcggcaagttcctcgcggacgcgtcgcttcgccgcgagttccttgcccttctgtccggc
aaggacgcgtag

DBGET integrated database retrieval system